Commit 94ffa7a2 authored by Davide Lagoa's avatar Davide Lagoa
Browse files

debug

parent c28f3605
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
package tcdb.reactionsGenerator;
import java.util.ArrayList;
import java.util.Collections;
import java.util.HashMap;
import java.util.HashSet;
import java.util.List;
......@@ -35,9 +36,9 @@ public class GenerateTransportReactions {
int noMetabolitesNoReactionsCounter = 0;
Map<String, TcdbMetabolitesContainer> tcdbMetabolites2 = new HashMap<>();
tcdbMetabolites2.put("P0AE74", tcdbMetabolites.get("P0AE74"));
// Map<String, TcdbMetabolitesContainer> tcdbMetabolites2 = new HashMap<>();
//
// tcdbMetabolites2.put("Q9Y6L6", tcdbMetabolites.get("Q9Y6L6"));
for(String accession : tcdbMetabolites.keySet()) {
......@@ -46,8 +47,8 @@ public class GenerateTransportReactions {
TcdbMetabolitesContainer tcdbMetContainer = tcdbMetabolites.get(accession);
for(String tcNumber : tcdbMetContainer.getTcNumbers()) {
// System.out.println(tcNumber);
// System.out.println(tcNumber);
TcNumberContainer newTcContainer = new TcNumberContainer();
......@@ -58,9 +59,9 @@ public class GenerateTransportReactions {
if(data.containsKey(familyTC)) {
try {
TypeOfTransporter evidence = null;
TcNumberContainer tcNumberContainer = data.get(familyTC);
if(tcNumberContainer.getAllReactionsIds().size() == 0) {
......@@ -69,7 +70,7 @@ public class GenerateTransportReactions {
}
else {
for(int id : tcNumberContainer.getAllReactionsIds()) {
evidence = null;
ReactionContainer reactionContainer = tcNumberContainer.getReactionContainer(id);
......@@ -79,10 +80,10 @@ public class GenerateTransportReactions {
if(evidence == null && proteinFamilyDescription.containsKey(tcNumber.replaceAll("(\\.\\d+)$", ""))) {
evidence = checkForEvidenceOfTransport(proteinFamilyDescription.get(tcNumber.replaceAll("(\\.\\d+)$", "")), tcNumber);
}
if(evidence == null && tcNumberContainer.getFamily() != null)
evidence = checkForEvidenceOfTransport(tcNumberContainer.getFamily(), tcNumber);
if(evidence == null && tcNumberContainer.getSuperFamily() != null)
evidence = checkForEvidenceOfTransport(tcNumberContainer.getSuperFamily(), tcNumber);
......@@ -91,28 +92,31 @@ public class GenerateTransportReactions {
Boolean antiportOrSymport = selectMethodOfMetabolitesDistribution(reactionContainer.getReaction(), reactionContainer.getTransportType(), dictionary);
// System.out.println();
// if(accession.equalsIgnoreCase("P26287") && tcNumber.equals("3.D.3.5.1")) {
// System.out.println("AQUIII" + "\t" + reactionContainer.getReaction());
// System.out.println("AQUIII2" + "\t " + antiportOrSymport + " \t" + evidence + "\t" + reactionContainer.getTransportType().toString());
// }
for(Set<String> metabolites : tcdbMetContainer.getMetabolitesCombinations(tcNumber, antiportOrSymport, accession)) {
// if(accession.equalsIgnoreCase("P26287") && tcNumber.equals("3.D.3.5.1")) {
// System.out.println("AQUIII" + "\t" + reactionContainer.getReaction());
// System.out.println("AQUIII2" + "\t " + antiportOrSymport + " \t" + evidence + "\t" + reactionContainer.getTransportType().toString());
// }
// if(accession.equalsIgnoreCase("P45539") && tcNumber.equals("2.A.3.8.17")) {
// System.out.println("AQUIII3" + metabolites + "\t" + reactionContainer.getReaction());
// }
// if(accession.equals("P45539"))
// System.out.println(metabolites);
for(List<String> metabolites : tcdbMetContainer.getMetabolitesCombinations(tcNumber, antiportOrSymport, evidence, accession)) {
// if(accession.equalsIgnoreCase("P45539") && tcNumber.equals("2.A.3.8.17")) {
// System.out.println("AQUIII3" + metabolites + "\t" + reactionContainer.getReaction());
// }
// if(accession.equals("P45539"))
// System.out.println(metabolites);
// Set<String> metabolites = tcdbMetContainer.getMetabolites(tcNumber);
// System.out.println(reactionContainer.getTransportType());
if(evidence == null) {
if(reactionContainer.getTransportType().equals(TypeOfTransporter.Uniport) || reactionContainer.getTransportType().equals(TypeOfTransporter.Symport))
if(reactionContainer.getTransportType().equals(TypeOfTransporter.PEPdependent))
newTcContainer = processPEPReactions(tcNumber+" "+accession, reactionContainer.getReaction(), "PEP-0" , reactionContainer.getProperties(), metabolites, newTcContainer);
else if(reactionContainer.getTransportType().equals(TypeOfTransporter.Uniport) || reactionContainer.getTransportType().equals(TypeOfTransporter.Symport))
newTcContainer = processUniportAndSymportReactions(reactionContainer, newTcContainer, metabolites, dictionary, tcNumber+" "+accession);
else if(!reactionContainer.getTransportType().equals(TypeOfTransporter.Antiport))
......@@ -122,7 +126,7 @@ public class GenerateTransportReactions {
}
else if(evidence.equals(TypeOfTransporter.RedoxQuinol) || evidence.equals(TypeOfTransporter.Cytochrome)
|| evidence.equals(TypeOfTransporter.RedoxNADH) || evidence.equals(TypeOfTransporter.MoreThanOne)) {
newTcContainer = processAntiportReactions(reactionContainer, newTcContainer, metabolites, dictionary, tcNumber+" "+accession);
}
else if(evidence.equals(TypeOfTransporter.Uniport) && reactionContainer.getTransportType().equals(TypeOfTransporter.Uniport)){
......@@ -153,9 +157,9 @@ public class GenerateTransportReactions {
}
}
}
// System.out.println(newTcContainer.getAllReactionsIds().size());
// System.out.println(tcNumberContainer.getAllReactionsIds().size());
// System.out.println(newTcContainer.getAllReactionsIds().size());
// System.out.println(tcNumberContainer.getAllReactionsIds().size());
if(newTcContainer.getAllReactionsIds().size() == 0 && tcNumberContainer.getAllReactionsIds().size() > 0) {
......@@ -180,11 +184,11 @@ public class GenerateTransportReactions {
newTcContainer.setSuperFamily(tcNumberContainer.getSuperFamily());
}
// System.out.println(newTcContainer.getAllReactionsIds().size());
// System.out.println(newTcContainer.getAllReactionsIds().size());
newTcContainer = filterUnwantedReactions(tcNumber, newTcContainer, evidence);
// System.out.println(newTcContainer.getAllReactionsIds().size());
// System.out.println(newTcContainer.getAllReactionsIds().size());
newContainers.put(tcNumber, newTcContainer);
}
......@@ -207,7 +211,7 @@ public class GenerateTransportReactions {
}
private static TcNumberContainer processBiochemicalReactions(ReactionContainer reactionContainer,
TcNumberContainer newTcContainer, Set<String> metabolites, Synonyms dictionary, String tc) {
TcNumberContainer newTcContainer, List<String> metabolites, Synonyms dictionary, String tc) {
// Set<String> preReactions = new HashSet<>();
......@@ -340,23 +344,23 @@ public class GenerateTransportReactions {
private static TcNumberContainer filterUnwantedReactions(String tcNumber, TcNumberContainer newTcContainer, TypeOfTransporter evidence) {
Set<TypeOfTransporter> set = newTcContainer.getAllTransportTypesAssociated();
// if(tcNumber.equals("3.D.4.10.3")) {
// System.out.println("Evidence" + evidence);
// System.out.println(set);
// }
// System.out.println("Evidence" + evidence);
// System.out.println(set);
TypeOfTransporter toKeep = TypeOfTransporter.Uniport;
if(evidence == null && (!set.contains(TypeOfTransporter.Uniport) || !set.contains(TypeOfTransporter.Symport) || !set.contains(TypeOfTransporter.Antiport)))
if(evidence == null && !set.contains(TypeOfTransporter.Uniport) && !set.contains(TypeOfTransporter.Symport) && !set.contains(TypeOfTransporter.Antiport))
toKeep = TypeOfTransporter.MoreThanOne;
else if(evidence != null && (set.contains(evidence) || evidence.equals(TypeOfTransporter.MoreThanOne)))
toKeep = evidence;
else if(!set.contains(toKeep) && set.contains(TypeOfTransporter.Symport))
toKeep = TypeOfTransporter.Symport;
else if(!set.contains(toKeep) && set.contains(TypeOfTransporter.Antiport))
toKeep = TypeOfTransporter.Antiport;
......@@ -364,16 +368,19 @@ public class GenerateTransportReactions {
for(TypeOfTransporter t : set)
toKeep = t;
}
// if(tcNumber.equals("3.D.4.10.3")) {
// System.out.println("tokeep" + toKeep);
// System.out.println(tcNumber.startsWith("3.D"));
// System.out.println();
// }
// if(tcNumber.equals("3.D.4.10.3")) {
// System.out.println("tokeep" + toKeep);
// System.out.println(tcNumber.startsWith("3.D"));
// System.out.println();
// }
// System.out.println(set.size());
// System.out.println(toKeep);
if(set.size() > 1 && !toKeep.equals(TypeOfTransporter.MoreThanOne)) {
// System.out.println(set + "\t" + tcNumber);
// System.out.println(set + "\t" + tcNumber);
for(int id : newTcContainer.getAllReactionsIds()) {
......@@ -395,7 +402,36 @@ public class GenerateTransportReactions {
* @param metabolites
* @return
*/
private static TcNumberContainer correctReaction(String tc, String originalReaction, String confLevel, TypeOfTransporter evidence, Map<String, String> properties, Set<String> metabolites, TcNumberContainer newTcContainer) {
private static TcNumberContainer processPEPReactions(String tc, String originalReaction, String confLevel, Map<String, String> properties, List<String> metabolites, TcNumberContainer newTcContainer) {
String[] result = originalReaction.split(ReactionContainer.IRREV_TOKEN);
String reactant = result[0];
for(String metabolite : metabolites)
reactant = reactant.replace("Sugar", metabolite);
ReactionContainer newReactContainer = new ReactionContainer(reactant, result[1], true);
newReactContainer.setTransportType(TypeOfTransporter.PEPdependent);
newReactContainer.setProperties(properties);
newReactContainer.setOriginalReaction(originalReaction);
newReactContainer.setConfidenceLevel(confLevel);
newTcContainer.addReaction(newReactContainer);
return newTcContainer;
}
/**
* Process metabolites associated to the wrong transport types.
*
* @param evidence
* @param reactionContainer
* @param metabolites
* @return
*/
private static TcNumberContainer correctReaction(String tc, String originalReaction, String confLevel, TypeOfTransporter evidence, Map<String, String> properties, List<String> metabolites, TcNumberContainer newTcContainer) {
Set<String> reactions = new HashSet<>();
......@@ -501,9 +537,9 @@ public class GenerateTransportReactions {
else if(tcNumber.equals("2.A.60.1.5"))
return TypeOfTransporter.Antiport;
else if(tcNumber.matches("3\\.D\\..+")) {
if(description.matches("(?i).*cytochrome.*") && description.matches("(?i).*quinol.*")) {
return TypeOfTransporter.MoreThanOne;
}
......@@ -524,7 +560,7 @@ public class GenerateTransportReactions {
else if(description.matches("(?i).*antiporte*r*[\\s*\\.*]*.*"))
return TypeOfTransporter.Antiport;
}
catch (Exception e) {
System.out.println(tcNumber);
......@@ -994,7 +1030,7 @@ public class GenerateTransportReactions {
* @param familyTC
* @return
*/
public static TcNumberContainer processUniportAndSymportReactions(ReactionContainer reactionContainer, TcNumberContainer newTcContainer, Set<String> metabolites, Synonyms dictionary,String tc) throws Exception {
public static TcNumberContainer processUniportAndSymportReactions(ReactionContainer reactionContainer, TcNumberContainer newTcContainer, List<String> metabolites, Synonyms dictionary,String tc) throws Exception {
String originalReaction = reactionContainer.getReaction();
......@@ -1125,7 +1161,7 @@ public class GenerateTransportReactions {
* @return
*/
@SuppressWarnings("unchecked")
private static String[] checkReactionsMetabolites(String reactant, String product, Set<String> metabolites, Synonyms dictionary, TypeOfTransporter transportType , String tc) {
private static String[] checkReactionsMetabolites(String reactant, String product, List<String> metabolites, Synonyms dictionary, TypeOfTransporter transportType , String tc) {
// if(tc.equals("3.D.1.1.1 P33602"))
// System.out.println(reactant + " <<<<>>>> " + product + "\t\t" + metabolites);
......@@ -1139,7 +1175,7 @@ public class GenerateTransportReactions {
reactant = (String) regex[0];
product = (String) regex[1];
metabolites = new HashSet<>((Set<String>) regex[2]);
metabolites = new ArrayList<>((List<String>) regex[2]);
}
......@@ -1168,15 +1204,18 @@ public class GenerateTransportReactions {
int confidenceLevel = 0;
for(String evidenceOfSymOrAnti : TWO_METABOLITES_EVIDENCE) {
if(reactantMetabolites.containsKey(evidenceOfSymOrAnti) || productMetabolites.containsKey(evidenceOfSymOrAnti)) {
// if(tc.equals("2.A.15.2.1 P31553"))
// System.out.println(metabolites);
// System.out.println(evidenceOfSymOrAnti);
// System.out.println(metabolites);
if(metabolites.size() == 2) {
boolean first = true;
Collections.reverse(metabolites); //this is important to respect TCDB order
for(String metabolite : metabolites) {
......@@ -1812,7 +1851,7 @@ public class GenerateTransportReactions {
* @param familyTC
* @return
*/
public static TcNumberContainer processAntiportReactions(ReactionContainer reactionContainer, TcNumberContainer newTcContainer, Set<String> metabolites, Synonyms dictionary, String tc) throws Exception {
public static TcNumberContainer processAntiportReactions(ReactionContainer reactionContainer, TcNumberContainer newTcContainer, List<String> metabolites, Synonyms dictionary, String tc) throws Exception {
// Set<String> preReactions = new HashSet<>();
// Set<String> reactions = new HashSet<>();
......
......@@ -30,8 +30,8 @@ public class Retriever {
///////// - SEARCHER
Properties properties = new Properties();
// Properties properties = new Properties();
//
// TcdbRetriever.getSubstrates(properties.getQueriesBackupDirectory());
//
// System.out.println("Retrieving TCDB FASTA file...");
......
package tcdb.triage;
import blast.Blast;
import tcdb.capsules.ReactionContainer;
public class Test {
......
#Generated by Maven Integration for Eclipse
#Mon Oct 01 15:09:50 BST 2018
#Wed Oct 10 16:12:25 BST 2018
m2e.projectLocation=C\:\\Users\\Davide\\Biosynth2\\triage
m2e.projectName=triage
groupId=tcdb
......
......@@ -148,6 +148,8 @@ MVNFDLGQVGEVFRRKDKGAIVSGDNPEEEEDVDASEFEEDEVKPVRTKNRRPKEDAFTQQRLAAINPVLTPRTVLPLYL
RGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDIYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMWACQRGNIRCNICI
>gnl|TC-DB|Q9UKX7|1.I.1.1.3 Nuclear pore complex protein Nup50 OS=Homo sapiens GN=NUP50 PE=1 SV=2
MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGGGRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSESESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
>gnl|TC-DB|ARF08724|3.A.3.8.23 soluble P-type ATPase [Catovirus CTV1]
MEGDNSIYLTRFKFSGLILYVCHIIYGYINYFFDFINIFCLLISFFQIYDYRDFRSFIPLSIFSTLYSVYYTYTVSKLIREQNSINSEMFMRKPINQIKRGDILELSYQDKIPADILILTDDFHVSTNELELSGENIVLNKKALFEDYDNNQLLKSNICINQKKNNGFIEYDNKKYKYDENNIVFRGTKMLDGKLKGLVVEIGNDCMIYNIDNRVLKDKTWLYKKVNNITFNNLYYLLIISAFIAGALKYVYPQRKFIFLVKTTVLLLNTVVPLSLQSFYNACTWILSRKIQTENNVTINSHGINCFENNPKYVVTDKTGTITKNQLKLIQVINISNKNNIIEKNDITNSSNINNFFDIMSCTLINTHSTTKQLLKNDEMEYLLLEWCCKNNKIKIMNNNYNEINKNLSFYKYKFNNKEEKINKIIYKGFDYKLGIKYCITEKDDIYTLNIQGTPEMINLYTNKNLINEGEKLLDEVSNNSYRRIICYAKKNITSDTYLDIKNNCNINEYLKDFEYANIYVFEDQVMDDLANHFDKLMKNGKHITILTGDRHSSSVEVGKILGMCDDMVLIDKKEDMNNIDKTVSLSVNGKIFNELIREEKFKNIILNTNKIIVYRATPEIKEKYIQYLKFADEKNQVMMIGDGSNDISAIMRADVGVAVKGESNQIQNISDVVIDSWCKIPELLKNFSYKKEIIEHNVKWVLTKHIMTATILMTMLLISNYKEIRDPTNPFHMLILNCLLFVCMSMFSFNNNLRIINNPINEKDYKTHIHKGIIVGMIIGTIVFTIFSVNIGIIIAIIAKFIYLSLIL
>gnl|TC-DB|Q9XTY9|8.A.80.1.2 Vacuolar H ATPase OS=Caenorhabditis elegans GN=vha-20 PE=1 SV=1
MKFVLLVSALVAACAASSLEIIAAPASLKFPDADATLKTTLISTLNENILGLSARQVDGFSVSVDMFSRPRALAVVTVIGADNLNLGGKTYSTKSDGVENVGFDQDMALIFGADRENVQVSAGGITGSMLALAAQQEAVDATVIKTKRSTLVKELEAVYQLAAAIKSAGVQMDNNADVFRVSITGLVGITESAQKEEAVADVKAAIEALTASINNAYGGQAVIELLAFEAESGAAEKSTESREIPNHNIQKRDTKSKTPTQLARENLQVTVPVSSDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMTTTRMKKD
>gnl|TC-DB|Q389P2|3.A.1.121.7 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.329.0040 PE=4 SV=1
......@@ -1706,6 +1708,8 @@ MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQPLRFALGIMDEPRRHLQDVWGVDVSGAGGNI
MRKERLEAYTDAVLAILITMMVLGIKAPVHDFQWSAVLKILPTLGIYSFSFFVLGTYWVNHFNLFRCVKKINSHILWYNNLSLFSFSFIPFSTSWLIEGLYYRAPETLYGLVLLISNIAYLLLILCLRKSNADAKELENQKIICTQSIILNIIALIMGQLIPIATLVINFINILLLWVYRAMINRQKIFKNNKKK
>gnl|TC-DB|ALM14817|9.B.105.1.9 lipoprotein signal peptidase [Candidatus Peribacter riflensis]
MGTVLVAGVLSAVASGVAAVLADRLLSERIAIFGSFVGLERSFNPGVAFGLTFVPWLQMGLILVALLAVASMVRTSQGRLQQAAFGLILGGGIANLIDRLRDGFVTDYFQVGTFPIFNVADSFITIGVLMLMMELVLKKRK
>gnl|TC-DB|GBG25729.1|9.B.311.1.17 Transmembrane protein 56-like C [Hondaea fermentalgiana]
MAQDGTTLLEASAAYLGKVLEPEQAQRVVASLALFFSLQALGKKVLPSVIPADRWDKLTDLEKTKISGWCVSIFHAVTGVSAATYIMATQEGTVVSDRIYGTSLNSCRLFNYTMAYFLWDLIMVFKAPTVDLGFLAHHVVGFATLVTMLHPFMQFYGLCCTLFELSTPFLSYRSIMLALGYKGSPAVKRAELLFGLAFLVGRILFGVPMAVYGTYEGTVALWKGLIQYKSHYAILFATNTIMIVLNILWFGKILRMSKKKPDNKKSD
>gnl|TC-DB|O55100|9.B.130.2.5 Synaptogyrin-1 OS=Mus musculus GN=Syngr1 PE=1 SV=2
MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWVFSIVVFGSIVNEGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFFWFVGFCFLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPSAGSDPAGMGGTYQHPANAFDAEPQGYQSQGY
>gnl|TC-DB|Q02920|2.A.53.1.5 EARLY NODULIN 70 - Glycine max (Soybean).
......@@ -3440,6 +3444,8 @@ MLKTYQKLLAMGIFLIVLCSGNAAFAATNQVGGLSNVGFFHDYLIEPFSALLKGVAGLFHGEYGLSIILVTIIVRIVVLP
MKNKKPRKFITQAPTLSLLALALLAGSVQAEDIGERTDQGTAMLASLQSEQGLIYLNADVWLKRQGATPLMTRDQLRERVLARGERLFIDFSAVTDQSERQQTRKAMEQLAGISFDADWVLVSGYKGELLFTPLGGVDDPAFYQVMERVESLEGQGKRHKRSLTQPPAAEAGLPHVAFYLNVNRKISDAECTFPRSRTWSRGDRLFCDSPNISLVYRVNLERSLQFGNTGSATPDAKIVRISLDEESAGAGIQLNEDLTWSENIADYLLLDGWARDYATDAIAQDYRFSIEASNTKAAVLKSLPTNLNSKYEHREISGFEVGVTGGVEVNKDGPKAKLEASAKFSQQRQLAYNTQDYRVERSAPSAQKVSFSWVRDQYATAESLLSSKTATVWGMGYDVDHNRIQPLSYKGFVPNLDVIYKAAPDETGSTEFKIDSSVNIRPIYTGIYKHYYVVGAHVSFQGFEDTDKRRRVTASTSFKVDWNHPVFTGGRPVNLQLGGFDNRCLSADANHGLSAVTCDETSAAQSFIYDQYGRYVSAQDTRRCLDGNNLGQLQSCSLSLGQRWEWKADSDALSNLSAHQLLGHDKQSGALGLYDENGNPQNVSVRTLTSYTRIFGPPASH
>gnl|TC-DB|Q38849|1.A.1.4.6 Potassium channel KAT2 - Arabidopsis thaliana (Mouse-ear cress).
MLKRKHLNTRPMSISCTRNFFKRFCVEEYNMDTFKHSSFLSADLLPSLGARINQSTKLRKHIISPFDPRFRGWEMWLVILVIYSAWICPFEFAFITYKKDALFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAPFQSLSLLFKYNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRCTKLISVTLFAVHCAGCFAYLIADQYHDPTKTWIGAVYPNFKETSVWSRYVTALYWSITTLTTTGYGDLHAENPREMLFFVFFMLFNLGFTSYLIGNMTNLVVHWTSRTRNFRDTVRAASEFASRNQLPPNIQDQMLSHICLKFKTEGLKQQEALNGLPKAIRSSIANYLFFPIVQNVYLFHGVSRNFLFQLVSDIDAEYFPPREDVILQNEAPTDLYILVSGAVDFTVYVGEEDQVQGKAVVGDAFGEIGVLCYTPQPFTVRTTELSQILRISKKSLMSAMRAHVEDGRVIMNNLFMKLRGQQSIAIDDPNSEPESLLKEWLVGGSKTGEGNASDQGHGHKYLQLHDSENIDMGSTEWRDSRRSGYGETKRVREHTIEIEEGEKPNKEFDGKGCSDADLTSFEFHSQEAYPYCRSNIQIKQHEAAKPKDKRVTIHLKSRDKDLSKLIILPASIEELLRLAGEKFGYSFTKVTNAENAEIDDEDVIRDGDHLYILINENS
>gnl|TC-DB|EJK43939.1|9.B.311.1.25 hypothetical protein THAOC_37567 [Thalassiosira oceanica]
MCAESRPSKVDKKSTPLKEDEIPSKELRSWVTDYRETRKIYIPGTDVDVGYALWWAMLFSLKRLFWRYALYALGWPRGSLETYFTSACVVAIYHSATLLFGLYAILRSQKYVPSGKLQPSPSWYNDATHSLMSFCTGYMIYDSIMGYVVETWQPGKGPVLTADDKLYLGHHILTTLYMMSARCIKAGHMSAMSLMFNGEFSSPFMNLSFILEKMLQSDCCRNFGWLPSLHVYAEQLFSIVYLICRVAVSPFVIGHVTFDLLFTKNGRRDVPIWISLLWMPLCWGVQFGSIGWIMTCIETIKTGPFGESLFGASLNEL
>gnl|TC-DB|Q86VL8|2.A.66.1.20 Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILATRH
>gnl|TC-DB|I3IWU8|9.B.130.1.2 Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700952 PE=4 SV=1
......@@ -3656,6 +3662,8 @@ MHYFEVAPTAIIRTGSDTFTYASQSPLPIGQLVVIEVGKKQLTGIITSATKKPSYETKSILSTIETAPLPTELIKLAFWL
MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEAGGGGPDRGPEAEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGEPRGEAQREPEDSAAPERQEEAEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSVEAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGRVGDSVDAEGPAGDSVDAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSGDGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVGDGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEEGPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKALRKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK
>gnl|TC-DB|P54702|3.A.6.2.1 FLAGELLAR BIOSYNTHETIC PROTEIN FLIR - Salmonella typhimurium.
MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP
>gnl|TC-DB|XP_004081268.1|9.B.311.1.6 transmembrane protein 56-B [Oryzias latipes]
MAMDPFSQLILTISVTSFLTFQWLFHRVSPWISIRISPGFLQLSDKQRVEWNSRTVSTFHALLVGLFCLHILVFDDAVNENPVWGDPTLVKINVAITTGYLISDLLLIFYYWKAIGDKFFVVHHLAALYAYYYVLGQGMLPYFANFRLLAEFSTPCVNQRWFFEVLGYPKSSRPNMVNGVAMAMVFFMVRVAVMPVYYGRMYAVYGTEAFYLVPWGGRVAWICSSICLDIMNIMWMHKIARGCYKVLRAAQRSKSGAPQENGKAD
>gnl|TC-DB|P54700|3.A.6.2.1 FLAGELLAR BIOSYNTHETIC PROTEIN FLIP - Salmonella typhimurium.
MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS
>gnl|TC-DB|P39137|2.A.3.1.11 Amino-acid permease ROCE - Bacillus subtilis.
......@@ -4176,6 +4184,8 @@ MSTPRRSLTPEMNVTPLVDVVLVLLIIFMVVTPQIESGAAVELPTATNPDKENKELTPTTVSLSATGAFFLDRKELKRDA
MNFNLRDIYNHMGVFALGIAWTLILFAVASLAVFFERLFVFFRSRSISKQFASRAGPLLTQHQHEALVKEAEATKGSHLAMLLGGGMKHFLAKSRVPAGKLGPVELTRRELVRINERVSADVRRGMSVLATVGSVAPFVGLLGTVVGIIEAFSGIAKEGSGGLGAVSAGIAEALVVTALGLLVAIPAVLMFNFLSTRADSLQLSLDAARSEFMDYLEDLGPQKPVATNGAAVATGPELAARKESRDVHPA
>gnl|TC-DB|Q8REZ2|2.A.57.1.11 Hypothetical membrane-spanning protein FN0939 - Fusobacterium nucleatum (subsp. nucleatum).
MSIELILFLAMIAVFAIACFVFKLPVSLAMVLSSITGTLIAGEGIPIRHLVEGMFGYLDTILVIATAMIFMKVIQEIGTLNALSATIIKKFHKIPWLLLIFLMFVSMFPGMITGSSTASVLTAGSIVAPILLLIGIPVTETATIIALGGLCGMIAPPVNIPAMIIGGGIDMPYVGFTIPLLLLTIPVAIFSVLFLGLKYVKKIDYDKIKNEIDFSAMEQYGIKLYLPVILAIFLMIMDKVLPNIFGLGMPLIFIISAFVGLFCGKKINFFKVSKNAINESLPVMGILMGVGMFIQIITLTGVRGYIVVNSLSLPQSLVYIAMAITIPLFGAVSSFGASSVLGVPFLMVFLAKNQIITGSAISFIASLGDLMPPTALAGIFAAQIVGMKDYTPVLKKSIVPAIVIIIYSILMIIFSKELAAIIY
>gnl|TC-DB|R7QSB7|9.B.311.1.27 Uncharacterized protein OS=Chondrus crispus OX=2769 GN=CHC_T00007108001 PE=4 SV=1
MDVTSFFVASSLWHLTYLATSSLLTHALSHPSSHAFLPSKSVRLRLQQEAPAYILSTIHAVIVTTRGLQHLRILLHAPVHIQLQHPPPALAASLPLAVLPFAAETRRVLDTNILLATYLFADLVHILRQYPALGGLDTVLHHLAFLLCAVVAGAYNLCPFMFSWLIIGEASTPFLNLRWFLIRSGYGDAWFFRPVQMIFALLFVVTRFFVYGAGMAYQFTIVSDVPDTVPRWAVVITLGSVVAGFVLNLTWLNKIWRLATGETRNQPEAHREKAA
>gnl|TC-DB|WP_035154315.1|2.A.128.2.4 VanZ family protein [Cohnella thermotolerans]
MAPRNSLPYPILRWLPTVLCMAVIFALSSRTGGELDSWLPWFQKLLPGLESFNPVHYVAYFALAVAFSFGFGFRRMDMRRCLAVVALCVLYGATDEWHQSFVPKRSPDIHDLLHDGIGAAVAVLVIWLWRARTLR
>gnl|TC-DB|A2RKA7|3.A.1.2.17 Purine/cytidine ABC transporter ATP-binding protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=nupA PE=4 SV=1
......@@ -5182,6 +5192,8 @@ MNNYQLTINEVIDIINTNTEINKLVAKKENLFPTDLYDLDKQELIAIILNSDFALSSIKRVLLEVTVEELGTQDNDEDDE
MALGDSFVRVAGTVLAILKTRFELISIEVEEEWTRLLAYLLLSLAGLFCLALTILLAVILIIVLCWESYRIPAMIGLIVFFGLVTLGIAIGVKRSFARKPKMLALTCQEIAKDIDRLTS
>gnl|TC-DB|P27650|2.A.99.1.1 Protein hupE OS=Rhizobium leguminosarum bv. viciae GN=hupE PE=4 SV=1
MKYSKITTTLAALALPSIAHAHVGLHADGTLAGLNHPFSGLDHILAMVAVGFWASTLGGKAVWIVPSAFVIVMAGGGVLGIEGIALPMVETAIALTVAMLGLLVAFEVKIPTPVAAIVVGICALFHGHVHGIELPTMSNATGYVAGFLAATVILHVLGIGLASLRFGKAGQVVARVAGGAVALAGAALLVG
>gnl|TC-DB|YP_009222254.1|1.A.35.3.7 Mg2+ transporter protein [Lactobacillus phage LfeInf]
MQQLYKIRSTHEIENIKGGDYDWLEITKPDDSDLSLVQKRTGLEISTSKLILSSHESSHIEGLTEPDKPLMIVLQYPKMVESNLGDFKEYATSPIILILSNDGDNNDLITISNHEPSFIAKIQEDSKSLKVPITNKKDIMLLVIYYMSQEYRSILRSLNKDANSLEQSLKTATNNIIFYHVMSIQKTVSSFLDSLANNQNICEKIENDANYFASEKYTELARSASLALEETSEAARHLDYILDKYTSLVSSIVGNNQLVTINKFTEWGIVLSFLSASFGALGMNYYLPGESSHVTTILVFATIFASSIWLSKYIRKLLKGKK
>gnl|TC-DB|P38307|3.A.16.1.2 Degradation in the endoplasmic reticulum protein 1 - Saccharomyces cerevisiae (Baker's yeast).
MDAVILNLLGDIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSIFDYGAFNWISMINIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGVLLHENLVYYELKKNGNQMNVRFFGVIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGHVIYYMDDIIGKIYGIDLCKSPYDWFRNTETP
>gnl|TC-DB|Q9UP38|9.A.14.16.1 Frizzled-1 OS=Homo sapiens GN=FZD1 PE=1 SV=2
......@@ -5242,6 +5254,8 @@ MQEENIVHRPLFKLSILSISLMTMIAPAISSALPLMYGSFKGETETAVETLVTVPNFGIIVFLFLSPFVIKLIGGKNTVI
MSTRSLAGRFFQTLFFEGAALALAVPLYALAFDARGGAALPVLLAVSAAAFLWAALYRVLFDWFHWHLTRRPEALRAAGTGLLRRISGRATALLLTFPLLIWLGALGPREALLAALALAGLHAGLGVAAGFLRGRGRPTALC
>gnl|TC-DB|Q4VQ66|3.A.20.1.4 Peroxisomal targeting signal-2 receptor OS=Leishmania major GN=PEX7 PE=2 SV=1
MPSFQMHPGFAGQSIRTNPWKPTQFIISTSQNFGIVGSGKAYVVEAAPGFQAGSPVSLVGCWGTSDGVFDACFSEVDQNIVVTACGDGVKVYNLAMSLNRDGVIPLVHNAEHQAEVSCVTWNSAHRDTFYSASWDTTIKMYSAVKPEVSMVTMQEHFKEVYEVASTAHSPSSILSCSGDGSWKLWDNRSPQRSVLTQMAHQNQIVLSIDFCKSDPNIFASGGVDRTVRVWDARRPNQPLASFPGHDQACRRVRFSTHNPSMLASSGYDMRVCVWDLSKPQQPLTARYQHHREFVAGLEWSQAAPNALASASYDGSAFFWSVGQAATPSLPTQQLPPAVPPPRVPRPRTKVLAGLPQPSMPMPMAVTSPPRSPR
>gnl|TC-DB|YP_009001498.1|3.A.1.211.22 putative ATP-binding cassette transporter [Anomala cuprea entomopoxvirus]
MLLPILWKHLITRFNKISSIILTVSEILIPILTIVLVLYYKSKLGNIDKIYINSTTYNDKLLCTDLLTELRIGNTKILYSPSTIYNDDLINRVKIKLNLYSNDIKYFQNEKKLIEYYNTNKFDDLSTIVVIIFNNTDKNLKYDIRIYENGIFWNTDKLFTNIYNYDLAASNTYITKSFNAIQLAIDISYIEMVINNTVDFQLTYQEFPYPPYLKTDNITISFRYILPFIIILGFILICPITLKTILMEKSSGLKELLKINGVKSVTLWIGWFLNQIIINIVSVIFICIILTTIRFSDKYRIIEHCNPLILIIFLLLYCSSTITFFFAFSTLFNKIILSMIMGILLWISIYCIFIINVENINDTIITNILLLFPPCTLYYGFDVLSLFEMRNTNINFDNLFESPAKGLSIGLVIIILFIDSILYFLIALYLDKLWPGKYGTSSSINMFNFRKKKTNQFLLQDLNSVIQLKNVSKIYNKKIKVIDDISFDIKKNKISILLGNNGAGKSTLMSMIMRMTSITSGHITGIERNKIAYCPQDNLLYKELTVIQHLILCGLLHGLNKNESKQKGEYLLKNVLNMIDKKNLYPNELSGGMKRKLSLGIALMTNPDVLILDEPTSSIDIEGRQEIYNLILSLNKTVLISTHLLEEAEYLADYIIIINSGKLLYYGNIIDLKNKYDIGYICTIKNKSIDENKIKEIVGHIKIKDDNIICNIDKTNKNKVPLLLKYLDELNIEYLFSSISLNDLYIKVQNKEIINNNNQYYINHINQSLRIKINYYFNKRKLFFIRKIKQYLYIYIISLCIIGLSIYLSNFGYVNLIDDGNKIKLDLDVYGHTDIYYSLVGQDSINIITHTSNSLIKVDNVNKSIIDVGINNIVHYIYKLIIAFEFNFTNNSINIMYSNKAYHSMPIAINVFSNTLLNYYTNDNYSIYLTHTPLHSNNKQIEKIQIGEYSNLFIWSILLPIGPLILISTSLLLPAIDYVKNIKTLERLCNIKAYQYWLFNYVFDITCYIASISIILIIIYIMPIHYLDVYTIIQLGGLFILYGIVFIPQSYIFTYMSTVENTYFNFLIVHIFCSPLISVILIIIDKEYIIILILLLSPHTSLCYYLASISIKLIRYHNWNIKSYEHKKAICSITDHVCCNLNSLECNDFKIFIDYKLIFCSIISLCISIFILLSMNYITRNISKLLLYKQFNKTNTQSTSNNNILYINNVSKGYWKWPCNVLKVINDITIVINNNICFGLLGTNGAGKTTMFKMMTNEIEPTIGKIKINGTIGYCPQQDSLIDEFTGKELLYLYGKLRGITNINHVVNKLLIKFDLCNIANQICGTYSGGNKRKLSTCLSLIGYPNCVLLDEPTNGIDPITRNELWDVIEYIKKKSIVILSSHNVHDCEKLCDNLCILHKGIVKEQTSIKKLKNKYCIGHILKLKFYDNKHIKIEHQLHSNFDTKNIKILSNHDYMITVRILNYNWITIFDIIERIKNDTENNIEDYWIMESTLDEALIEIANNKL
>gnl|TC-DB|767523289|1.A.40.2.3 vpu protein [Simian immunodeficiency virus]
MHYRDEIVLLIAGVLIGGCLIIWGYLLLYWLKERKRDIFVQRVARLRKRQEDEGYESNEEEEEKLRELGAQLGFAYYML
>gnl|TC-DB|O31563|2.A.1.3.58 Uncharacterized MFS-type transporter yfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1
......@@ -5310,6 +5324,8 @@ MTTWAVVNLVNLLQAVGFASRPRHGMAVNRALGVVIAVLAVPATVALVIYARARSPWWAGPALFDLFVIFMLAVDYVRPV
MAISTIQIILIFIWSSVVGMGSVLDEFQTHRPLIACSIMGLILGDPKTGIILGGTLELIALGWMNIGAAQSPDSALASTISTILVIVGNQDIQKGIAIALPVAAAGQVLTVLARTVTVAFQHAADREAEKANFTAIIWLHFTALIVQALRVSIPTTIVAVFVSPEEIKSMLDALPEVITGGLAVAGGFIVVVGYAMILNMMSVKYLMPFFYQGFVLGGYLKLSLLAWGAVGLIFAIVYVQLNPKFATNHNNGTGGSGGTVAAAGDHPAALPEDELDD
>gnl|TC-DB|C0BVR9|1.E.9.1.4 Putative uncharacterized protein OS=Clostridium hylemonae DSM 15053 GN=CLOHYLEM_03932 PE=4 SV=1
MGIIIIFLLVIYMLPSIIASCKNHLELKAVLCVNVFLGITGIGWITALIWAISDSRVHYLKKNKEKLETGLISLQEYEENLKKIDKK
>gnl|TC-DB|AEO97646.1|2.A.20.2.13 sodium/phosphate symporter [Emiliania huxleyi virus 84]
MSGFVEYTWIVVFGAFAAFFAAFGIGANDVANAYATSVGSKALTIKQACFLAVIFEFLGAVLAGSAVAETIRKGTADYECFDGSYMDRAILMYGNLCVIGAVGMWLLVATKFEMPVSTTHSCVGGLVGMTIAAKGADCVVWYKEIDIDSGKYLPGGIVGIVLSWVFSPLLSGIVAVLLFLSIRTFVLRSAQPFIRSIRAYPFLVWGAVTINSFFIISKGVSKKICPSKYNIWICQGWDASLPNGAEVTKAIAPGKVNAGIAFGLSAGFGVVAAIALIPLYKYIHRTTLDTFSKPKQIENKAENIEKPKNILAKTARKLFDRDIHAITVTDEKVSVIHNNAEQFDEKAEYVFKYIQIFSAIFDSFAHGANDVANAMGPFMTIWVIWKAEGEAIGGSKTDIGDDSYWILAIGGIGIGIGLLLYGYKIMQEIGVKLAVITPSRGVCIELGSAVVIITGSYMGIPLSTTHAQVGATVGVALLEGKKGINTKVLSKAGFGWIVTLIVAGLLAGLLTSQGIYSPINEYAFNSAIVFNETS
>gnl|TC-DB|GBG82755.1|8.A.111.1.7 hypothetical protein CBR_g36285 [Chara braunii]
MEVVGDGRRLRVRRGKGGEVLLPSSLCLWGLLLGALSLLLWGAECGAYSYSYGYGGGDGGGRPIDLNQVKALTLRKGEYTAGRRLPGVPQLQCVGGCDYEPEDDRVLEGSCGLSYTLKRLPGGGGKYNSRERYERTQKKSWGFGKLIGFAVFAYFGLRIWQLCAKARQHRSDDYQPSAPPYPGNGFSAPGSAFPSPPYYAAPQPPPHGYPDSQGYGASVPRPPGSGIASSGISWPSAFSGFGLGYLFGRSGHGNPTAGGGYSQPSRRRPWNSSDNGSHNIAETWPEEEKSHQRHQDSFHTSTAYASTSKR
>gnl|TC-DB|O31580|9.A.32.2.1 Hypothetical protein yfhL - Bacillus subtilis.
......@@ -5874,6 +5890,8 @@ MVKGSVHLWGKDGKASLISVDSIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKLPVLILDNGTKVSGYVNIVQF
MSRPCAMGRAIRSVFSLLFLLAVGIAEADEQSPEVRSSGRSSPSTSHSAAPEVASDASASYNTRMALVSDVTNRFTVETAETSTSTSVRPASAESYTPDLPDHVDVVATDVASADDRRPPLVAGKSTIALAVVKPDAHQDISTSLPASGSDAPSANSTDDGYPPSSLPPAGDGRTTPWTPLNSSEQFFDGATPDASGEVPSRPPVARHINAEVLHPSIPPDRPDSLVSKDSVSQIYPLTVRPGGHAQPTADVNRPSLIRDASTLFTTTPATPVDGLAATKAREGAVDEAPGTGGSYDGNATEGQTTSRRPIDAGNRHSNDDDDSNASAAEKHGTQTHNATDHQLEYGRSFERVLLKDYTEFVAVRGRYTVRRRTKSTPQLECVAGCSDSLFPSEIRCTQHLHNGSTPQWQCTARLPKHVTLIIVSINCEGFDQTYDNFITNGSCFVKFSLQNRAHGAHVSDGEHSNRRSPGLEQFDARSFNPTNDNFVIYPYFIPAIVLVGGIVFVLMVFSCLCPREKEESPMPPMQPAPTPIYQPPQAQMNNQAMALQQQSFQNPHSNPHPFAPPTYGADYVPPAGPGFTAPQPPGQYPPGQYSPGQYPPGPSYPPGHYPSGQYPAAAPYAPPGQTATPVIQGQSNRSGGGLSGLGGLAVGAAAGGLAGYAIGSMMHHHGEHGSGEGGHESTTTADVEVQRDIDVIQEYPARGGMYGEADGGSRVDTYQQPTYASDQPVYASDQPSYVAPDTYEPPPLDAGGFGDDDFGGGDFD
>gnl|TC-DB|P25197|2.A.6.3.1 Nodulation protein nolG OS=Rhizobium meliloti GN=nolG PE=4 SV=2
MFLTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVESEISRPIEAALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFPDGVATPQVTRYKPEGQAILSVAVSSTSRTLPEITTLATRVINNRLSVISGVGQVSLIGSSERQVLVVVDPDRLGAYGLAVSTVIEAIRGENQDRAAGTLISGINQRIVTVEGRIANTSGFNRIIVAQRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLGLHIVKVQGANTVEVASAVRREVSALNAELTKDNVQLTITRDNSRPIASQVSQVQRTLVEGGVLSVLIVFIFLNSWRSTVITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDDAIVVRENITRHLQMGKDPVRAALDGTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGRFFLQFGVTVAVAVVISLFVSFTLDPMLSSVWCDPQSQKTAKRGFFGQLIERFDQWFEGLASRYRSVIYFTFDYRKTTIAIVLGMFVVSLLLVPRIGTEFLPPPDQGEVSISLEANEGASLDYMAAKVGQIERALREFNYVSSTYSTINSGEMRGFNKALVAVQLVHSSQRRLKTAETLGPIRRRLSRIAGLEISVGQRSEVVGSIKPLQLSILGDGDEELRRISDHITSVLAAIPGATEIESSIEKLRPTLAVRVRREAASDLGVSIATIGDTLRSLVAGDAISVWNSPDGETHDVVVRLPAAGRENAAQLRNLPIATARMDDNGKPIMVLLDQVADVVESTAPAQITRKDLSRDIRISSNIEGRTLGDVVADLKAAMTKMDIPVGFRISFGGDAENLTESTAYALQSLAMAVIFIYIILASQFGSFIQPIAIIMTMPLSLMGVLLGLLFTGSTLNMFSMIGIMMLMGLVTKNAILLVDYSNLGVREGKSLRQSLADAGAVRLRPIVMTTLAMIFGMLPTALGLGEGGAQRAPMAHAIIGGLISSTLLSLVFVPVVLTYLDAFAGRVRRWVPSPTGSNASAQHDGSDKTKTPACALTSQDQLGTTIM
>gnl|TC-DB|Q12767|3.A.3.2.47 Transmembrane protein 94 OS=Homo sapiens OX=9606 GN=TMEM94 PE=1 SV=1
MDLKEKHLGEPPSALGLSTRKALSVLKEQLEAVLEGHLRERKKCLTWKEVWRSSFLHHSNRCSCFHWPGASLMLLAVLLLLGCCGGQPAGSRGVGLVNASALFLLLLLNLVLIGRQDRLKRREVERRLRGIIDQIQDALRDGREIQWPSAMYPDLHMPFAPSWSLHWAYRDGHLVNLPVSLLVEGDIIALRPGQESFASLRGIKDDEHIVLEPGDLFPPFSPPPSPRGEVERGPQSPQQHRLFRVLETPVIDNIRWCLDMALSRPVTALDNERFTVQSVMLHYAVPVVLAGFLITNALRFIFSAPGVTSWQYTLLQLQVNGVLPILPLLFPVLWVLATACGEARVLAQMSKASPSSLLAKFSEDTLSSYTEAVSSQEMLRCIWGHFLRVLGGTSPTLSHSSSLLHSLGSVTVLCCVDKQGILSWPNPSPETVLFFSGKVEPPHSSHEDLTDGLSTRSFCHPEPHERDALLAGSLNNTLHLSNEQERGDWPGEAPKPPEPYSHHKAHGRSKHPSGSNVSFSRDTEGGEEEPSKTQPGMESDPYEAEDFVCDYHLEMLSLSQDQQNPSCIQFDDSNWQLHLTSLKPLGLNVLLNLCDASVTERLCRFSDHLCNIALQESHSAVLPVHVPWGLCELARLIGFTPGAKELFKQENHLALYRLPSAETMKETSLGRLSCVTKRRPPLSHMISLFIKDTTTSTEQMLSHGTADVVLEACTDFWDGADIYPLSGSDRKKVLDFYQRACLSGYCSAFAYKPMNCALSSQLNGKCIELVQVPGQSSIFTMCELPSTIPIKQNARRSSWSSDEGIGEVLEKEDCMQALSGQIFMGMVSSQYQARLDIVRLIDGLVNACIRFVYFSLEDELKSKVFAEKMGLETGWNCHISLTPNGDMPGSEIPPSSPSHAGSLHDDLNQVSRDDAEGLLLMEEEGHSDLISFQPTDSDIPSFLEDSNRAKLPRGIHQVRPHLQNIDNVPLLVPLFTDCTPETMCEMIKIMQEYGEVTCCLGSSANLRNSCLFLQSDISIALDPLYPSRCSWETFGYATSISMAQASDGLSPLQLSGQLNSLPCSLTFRQEETISIIRLIEQARHATYGIRKCFLFLLQCQLTLVVIQFLSCLVQLPPLLSTTDILWLSCFCYPLLSISLLGKPPHSSIMSMATGKNLQSIPKKTQHYFLLCFLLKFSLTISSCLICFGFTLQSFCDSSRDRNLTNCSSVMLPSNDDRAPAWFEDFANGLLSAQKLTAALIVLHTVFISITHVHRTKPLWRKSPLTNLWWAVTVPVVLLGQVVQTAVDLQLWTHRDSHVHFGLEDVPLLTWLLGCLSLVLVVVTNEIVKLHEIRVRVRYQKRQKLQFETKLGMNSPF
>gnl|TC-DB|Q7XBS0|2.A.21.6.3 DUR3 OS=Oryza sativa subsp. japonica GN=Os10g0580400 PE=2 SV=1
MASGVCPPAELGFGAEYYSVVNGVCSRAGSYFGGRPVLTQAVGYAVVLGFGAFFALFTSFLVWLEKRYVGSQHTSEWFNTAGRSVKTGLIASVIVSQWTWAATILQSSNVAWQYGVSGPFWYASGATIQVLLFGVMAIEIKRKAPNAHTVCEIVRARWGTPAHLVFLTFCLLTNVIVTAMLLLGGSAVVNALTGVNVYAASFLIPLGVVVYTLAGGLKATFLASYIHSVVVHAVLVVFVFLVYTSSSKLGSPRVVYDRLMAVASAARDCSADLSRNGQACGPVAGNFKGSYLTMLSSGGLVFGIINIVGNFGTVFVDNGYWMSAIAARPSSTHKGYLLGGLVWFAVPFSLATSLGLGALALDLPLTAAEAAKGLVPPATATALMGKSGSVLLLTMLFMAVTSAGSAELVAVSSLCTYDIYRTYLNPGASGKQILRVSRAVVLGFGCFMGVLAVVLNVAGVSLGWMYLAMGVIVGSAVIPIALLLLWSKANAVGAMGGAVSGCALGVAVWLTVAKVQYGRVNLDTTGRNAPMLAGNLVSILVGGAVHAACSLLRPQHYDWGTSREMITTVESVHAALDDELKEERLVHAKRWIVRWGLVFTAVIVVAWPALSLPARRYSLGYFTLWAAVAIAWGTVGSVVIILLPVAESWTTITKVCAGMFTNDAVYDRLDDVNLRLRAIMGAMPEAEKRYRQLHETEMHPAGTHPANDDDDDNNNNQMMHS
>gnl|TC-DB|P25190|1.G.18.1.2 Spike glycoprotein OS=Bovine coronavirus (strain F15) GN=S PE=3 SV=1
......@@ -5932,6 +5950,8 @@ MKPIQLFIVAVAVTGALTLTACTHMLSKESSLPSWHPESLATGRVDCTECHEDRARGVLKPYAAFSHTPVFVRDHRYYAG
MKIIIIGCGRMGSGLAMRLVRSHHEITVVDHDHRAFDRLGAGFSGMIIEHDAMDKKSFTMSGVEKADGLAAVTGNDAVNIVVARAAKQMYRVPKVIARTHDPRYAELYHKLGIETVTNVTLGIERISELLTFSTLDIIHGIGDGEVGIVRYDIPPLLAGHQVKDLTVPGEIIVLSLTRKGKTSIPTLGTTLEKGDVVHIAVEERAVDRLKNEMRTVGGG
>gnl|TC-DB|Q749L8|5.B.8.1.2 Cytochrome c OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU2724 PE=4 SV=2
MKSTIVRFLTVFCVGLALWGCSSGSGDAPAIDPTTGRHPANWIETHWGEFRKDRDQCVSCHGSYLDAGQSGGISGVSCFSPNRGAQVCHATGPAGHPAGWGAADQHGRSGAMAAPAVAAGFAYCSRCHGALFDNGPARSCFACHTNAPHPDAPWHGTTASGTNHIFVDQGNAPECAKCHATGANSTLQPTTPAPAGTPAGCFNNTLCHGAEAGHPAGWSDPNSANFHGPRAKAADSPSGGFSYCRRCHGANYQGVGTAVSCFSATVGAFSCHNGGAPAIAPHSPAPWRAARTHTNTDTTNAASCAACHANGANSTRQPTTPAPAGTAAGCFNNTLCHGSDVQPPHPVAGAYLPSAQHGADAINRNNNGTGLNTCQPCHATPASGANPRFNVPRGATLTAGCETCHTARTAHPTPWLIGRGTTQGVTNQLRHSTLAVLATAGTAVTNYCTLCHGANLDGAGGVAPSCVSGSSRLNIAGVNAVCHFNAVAVKDSGTGLFNIQTGCVSCHGNPPVGSTFPNRDLQHTEHLFPNVTCGSCHSGAGYATVLHGNGTANVVLSATFQDKDGGAPAYNAGTGTCSNVSCHGGQTSPPWPSGQINVSTDCASCHAYGTTQFNSFSSGDKRHHTEITLVCSECHDTTKLATTHFTNLQTSAMEGPASSTLLDSLNYDPATRSCLFTCHIGNENHTRSMTW
>gnl|TC-DB|WP_092049080.1|9.B.309.1.2 DUF2177 family protein [Planctomicrobium piriforme]
MQTLKLLGVAMLAVTVLDFIWLGLVMPRFYDQQLGEIARRSGASLAPRWSAAIIVYVLIPLGVVLFVRPLFTPTTTLWQALAWGALYGLILYGTYDFTNLATLEKWNWKLALIDTAWGAAICGLTSVAVKAALDWMNKA
>gnl|TC-DB|Q6H9L9|1.C.47.1.7 Gigasin 2 protein (Fragment) OS=Crassostrea gigas GN=amp-Gigasin 2 PE=2 SV=1
MKVLVLLTLAVLLMVSADMAFAGFGCPGDQYECNRHCRSIGCRAG
>gnl|TC-DB|R4VYX5|1.A.16.4.3 Formate/nitrite transporter OS=Salinarchaeum sp. Harcht-Bsk1 GN=L593_12630 PE=4 SV=1
......@@ -5940,6 +5960,8 @@ MDEDGPGDESVRDAIEQSRHGAPAAGSVVRDQFETHEVFQRIVAAADEEATTGTRELFFSGLAAGFAITVTFLLYASLTA
MFLSMRTGTVPVPEVGAPPERLHYLDSIRIALSVLVILHHAAQPYGPADWWYVESLPKAQWIEDCAVLNAPFKMSLFFLIAAYVLPSAVDRRRHRPFLRTRLTKLGGPIVIGFFLVIPVLMYAYYLEFRPYGHIGFGDYYWNVYLGNGEEPRNWSGPIWPDRQFGHLWFIQHLLVYSLAYLVWRMAAEAVRSRRNLPRVPESRAVPEHAGGLAVFAFAAVVAIGTALLRIRYPVDQWVPVAEIIQTEPADLAQHIPFVIAGVLAYRRGWLTTLSARVAYSWFAAAVALTVLYLVFRDELTGYFAWGGTDMGQFAWSGYETVLCVGYALGLLVFFRDRVRGTSDLRRSAAQATFAIYLLHLPIVVGLQYLVRDWPLEATGRFLVVGTLGCVLSVATALVLRRTPMVRAVL
>gnl|TC-DB|H9UJI5|9.B.184.1.4 Uncharacterized protein OS=Spirochaeta africana (strain ATCC 700263 / DSM 8902 / Z-7692) GN=Spiaf_1620 PE=4 SV=1
MSTIRIGIISAVMLCAAVVLTAQEPGEFEPAGPDFFTHDLGDQQFSIRLGGFRPLFFSGNDDGLQSTNMRWGGAGALRWNAYLNNWFSTGVELSGSLASNVNREQLYQFNLSSANTFYPLHIDPFFFPISLDIGAQFMRFQDMFYFGPVVKPGAGMFYATDGGWSFGLWAIYWVVPEIYTDNSSPGSADTRIGNFLELSLTAMYHF
>gnl|TC-DB|XP_005649569.1|9.B.311.1.4 hypothetical protein COCSUDRAFT_65066 [Coccomyxa subellipsoidea C-169]
MVEDRKMHFGQATTSGMSSFEPTTQESLTRIALTGFLFIAVDIAISNGPIRQWMQRHFRSWAAPGVKLAEVDKAVPHISTRIVSSLHILIQIPLAIIVLLSPDLQADRLYSKSPLTWQLVTTTAGYFVYDLYVHTVRYEYTANLVHAAAALSVFLTGIYCGVLHYYGAMFLLWECSTPFVFMRWVLHTLGRTKDKFYLYNGLTMMAVFFLCRNLLGVGMSLDFWRVSGAELAHPRPGGVPASALWLIRGLNLVFNFLNFLWFSKMLRGAIKVLQKSPAAMEATAEAQVALSESKKKHEE
>gnl|TC-DB|C7PTR5|1.B.72.1.5 Uncharacterized protein OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=Cpin_5392 PE=4 SV=1
MEIRQRLGKLLVACCAYGGCFTSVVAQQATPFKPILRADIAATGVRNHLIWSVAGNSQGTAPNIMSELEWYAQSGIGMKGSLTYQPFRRWFTTLSFSRAGYISGHATDNDYQEDDRQYPTFAGKFRADRGRIKELHGVVGFELYTSGRISWNIQTGYTEQHQLNYLLPADVLTPQDLRTTYFSKWSGMLINTAVQWQTSDNTLLRGTLAYSQLWYRAEADWNLIPSFQHPLSFLHVAKGYGLRPAVAMEKRLLGFTAVQLELACDYRITGHGSEQLYLRNGGLAVTRLNSVKSRGWSLSIGVPFSFLQ
>gnl|TC-DB|A0PJK1|2.A.21.3.15 Sodium/glucose cotransporter 5 OS=Homo sapiens GN=SLC5A10 PE=1 SV=2
......@@ -7112,6 +7134,8 @@ MSNGHRYGIFYRWLLPAIIFQSVFMGGGFTTGREVMEYAGKYGVYGIYSVVIATILFFISAALSYEVARVFKAFDYRTWV
MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
>gnl|TC-DB|O31241|1.C.12.1.9 PYOLYSIN - Arcanobacterium pyogenes.
MKRKAFASLVASVVAAATVTMPTASFAAGLGNSSGLTDGLSAPRASISPTDKVDLKSAQETDETGVDKYIRGLKYDPSGVLAVKGESIENVPVTKDQLKDGTYTVFKHERKSFNNLRSDISAFDANNAHVYPGALVLANKDLAKGSPTSIGIARAPQTVSVDLPGLVDGKNKVVINNPTKSSVTQGLNGLLDGWIQRNSKYPDHAAKISYDETMVTSKRQLEAKLGLGFEKVSAKLNVDFDAIHKRERQVAIASFKQIYYTASVDTPTSPHSVFGPNVTAQDLKDRGVNNKNPLGYISSVSYGRQIFVKLETTSTSNDVQAAFSGLFKAKFGNLSTEFKAKYADILNKTRATVYAVGGSARGGVEVATGNIDALKKIIKEESTYSTKVPAVPVSYAVNFLKDNQLAAVRSSGDYIETTATTYKSGEITFRHGGGYVAKFRLKWDEISYDPQGKEIRTPKTWSGNWAARTLGFRETIQLPANARNIHVEAGEATGLAWDPWWTVINKKNLPLVPHREIVLKGTTLNPWVEDNVKS
>gnl|TC-DB|XP_001441852.1|9.B.311.1.16 hypothetical protein (macronuclear) [Paramecium tetraurelia strain d4-2]
MLNLENIDLVNSTSDQVKVMSYSFFIWTSIFAIINQRVHLKNHPKKVQDDIKNRIVSIIHGALTFWAAAYIVLVEQPSFGAANSQTMQFTMIISASYFVYDFLACLYYDLADMSLVSHHSLAICGYAVATFSKFGAPSSIWGLMSAEVSNFPMHMRVIFRQVGLRHTKLYEACEWTYFALYIIFRGSLVPYMVWNTWPESEVPLLVKITATGLFLQSVYFIFEMKKILTRQYFQYQERKKKNIHHYWFQVNPRIQELSYINNQKKDKVF
>gnl|TC-DB|P41732|8.A.40.1.2 Tetraspanin-7 OS=Homo sapiens GN=TSPAN7 PE=1 SV=2
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV
>gnl|TC-DB|Q8EDM8|1.B.14.8.4 TonB-dependent receptor OS=Shewanella oneidensis (strain MR-1) GN=SO_2715 PE=3 SV=1
......@@ -8964,6 +8988,8 @@ MSELLYAVVNGAYLFLVLQLLFLLVVVWQNVVAASLLFLFVSLSCLEAVRWGALESGKQQNQSLNAEVVVVSPSTAELSR
MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCHLNEGVSGHSHHHH
>gnl|TC-DB|Q92NE9|3.A.1.5.17 PUTATIVE PERMEASE ABC TRANSPORTER PROTEIN - Rhizobium meliloti (Sinorhizobium meliloti).
MNLRSIPFSAWIGIIGIAVALLCALFAPVLAPFGEREVVGEIWLPAGGDFLLGTDNLGRDLLSRLIYGARTTIFVALAATVLSFALGMILSFTAAVTGGFVDQFFSRFNDLMMAVPTLIFALVVLAVLPQHLWILVLVMAVLDSTRVFRIGRAVALDVAVMEFVEAARLRGEGNVWIIFREILPNTLSPLLAEFGLRFAFSILFLSTLSFLGLGIQPPAADWGGMVKDNKDGIIFGISAALIPGAAIAALAICVNLVVDWLMKRTSSLKGGRGDA
>gnl|TC-DB|YP_294138.1|9.B.309.1.5 hypothetical protein EhV380 [Emiliania huxleyi virus 86]
MISIGLPNILKACLGYIVIVLMDAIWLPFATYMEFYPKLDDTHILFAILAWMSIATLLSCGNVSSGKDAAIFGMYVGLIACSTWNFTEAAVRKDWRNTAILFDLTYGTLLCAFTGFVVYKIDASI
>gnl|TC-DB|P51788|2.A.49.2.12 Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2
MAAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWKGPPSSRAAPELLEYGRSRCARCRVCSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWVMDYAIAACLQAQQWMSRGLNTSILLQYLAWVTYPVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVLKEYLTLKTFIAKVIGLTCALGSGMPLGKEGPFVHIASMCAALLSKFLSLFGGIYENESRNTEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFIFRVLAVWNRDEETITALFKTRFRLDFPFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMRKQKTINRFLMRKRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLVEELEPPSTSQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGIHTDSSTYRIVPGGYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMIAVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCTFRDLRLALHRTKGRMLALVESPESMILLGSIERSQVVALLGAQLSPARRRQHMQERRATQTSPLSDQEGPPTPEASVCFQVNTEDSAFPAARGETHKPLKPALKRGPSVTRNLGESPTGSAESAGIALRSLFCGSPPPEAASEKLESCEKRKLKRVRISLASDADLEGEMSPEEILEWEEQQLDEPVNFSDCKIDPAPFQLVERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ
>gnl|TC-DB|P51787|1.A.1.15.6 Potassium voltage-gated channel subfamily KQT member 1 - Homo sapiens (Human).
......@@ -9292,6 +9318,8 @@ MAKVLTLLVLRLLMNLLLIGWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQH
MAIQKILFASLLICSLIQSIHGAEKVRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTLSSIGSKREAEFKIIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPYDKTLQSTTWTLERDIPTGTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDIASICFSVFSVVALVVFFVNEKRKAKIEQSK
>gnl|TC-DB|P49447|5.B.2.1.4 Cytochrome b561 - Homo sapiens (Human).
MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ
>gnl|TC-DB|XP_005770408.1|9.B.311.1.28 hypothetical protein EMIHUDRAFT_447899 [Emiliania huxleyi CCMP1516]
MTLQEFSDLEQRVFARASARAAQPAPLSSLGHYKMAWGKPPPQPAAAVVPSMSLSDLLSDEWVLQWVGGLFVLQFGWMALLYVVPSPMSSDVGMAAHQLTAAVPFAYAAYHGTRLWYFDEQHAALGADARGRLYAASEDAFSLARFMFGMQVFDLLVTLIVPSLRKAEHLVHHGMTLLTALCGLSGPFLMYQAAFFFGFVEVSSLPLVFVDLFRQFPRLHEGSPAGHSVNEMVRVAFALSFLLIRCVLWPLAVLQLLRDLYAVWAAGELEGQLQMATFCVTCSVLTFLQLYWGGKIVRALLKMLAGDSSGREKEA
>gnl|TC-DB|Q9U280|3.A.3.8.15 Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3
MPTEARDNNRHIHLGKVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVARHFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSFLWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFADASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKHVVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRAFSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKRTTSFNGFERLASYSSNVLENMRLLTSSLRGSTTGSTRSRTASEASLALAEQTRYGFAFSQDESSAVAQTELIRNVDSTREKPTGR
>gnl|TC-DB|Q5Z8H2|3.A.1.139.1 Sensitive to aluminum rhizotoxicity 1 OS=Oryza sativa subsp. japonica GN=P0622F03.26 PE=2 SV=1
......@@ -9532,6 +9560,8 @@ MSSGEVESVTVVRPLKIMAFVCGCLALILAITCIASDYWLEADGFRQGLWRYCFQPSEGADYGCADNDKVFSERQTWITA
MTFNIDSNIAILIITWLVVQVLKPTKINNHLLPLVAVIIGALVAVALSLYTKDTKLVQDVVLGVWAGFASTGLNETATKSITSIIDGFSNGFGKSEEKKTE
>gnl|TC-DB|Q1D0C6|2.A.1.49.7 Major facilitator family transporter OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5760 PE=4 SV=1
MNAQSAASPAASAVPASNAGYALLILTLINLVNYLDRYIVAVALPDIQKEFGINDTQSGLLGTMFIVVFMLASPLGGFLGDRYPRRLLVVGGVVLWSLATGASGLATSFGALLLARAVIGIGEAGYGAVAPSIISDLYPRTQRTRMLAFFYIAIPVGAAAGYGLGGWLTQAYSWHVAFFAGGVPGLILGAMAFFMPEPQRGAMDGPDAQAKLPFMVGLKGLARNSAFWAVTAGYTLMTFSIGGLGFWMPTYLVRERGLAQDSSGFIFGAITAVAGLLGTVAGGWLGDKLDRKREGGGLWMSGIGLMLAAPCMYLAVSLKAVGPTFAAIALAQFLIFLNSGPINAAIVNCVPPAFRAFAMGLNVLCIHLLGDAISPTLIGTIADASSLHTAIAVNALPVLLGGFALLLGARLFREAVPLARQG
>gnl|TC-DB|Q38C29|1.A.77.1.7 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5600 PE=4 SV=1
MVGTVLRVYTHRTRCIGELCSVAPLCVILEQRRPGPSFGIRSQSREDNSVHFLPCEGAVDLSLRALSTIEGLRNYREHRLRPQLLVKRAELRQADDVKTRCDALGLRYADRCIAIAVALILIRNVVLFYWVYFLFDWNLVEPITYLLERGAVCLGFLWYGATSSDARFESFRQFLVSRRTQRLYAQHNFNAGHWKELVVEVEGLEEQLRGLETV
>gnl|TC-DB|D2Z3Q3|1.E.5.3.3 Putative uncharacterized protein OS=Dethiosulfovibrio peptidovorans DSM 11002 GN=Dpep_0327 PE=4 SV=1
MLDDIMETLRHILALLLPPALMAMGGSAVKYGRLHRSESFSWREFLVGMATAGFAGMVMHCLCRGLGLNIWITSAVVAMSGYSAGQLLDYGQELLLKWLERKTR
>gnl|TC-DB|B4EY22|2.A.15.2.2 L-carnitine/gamma-butyrobetaine antiporter OS=Proteus mirabilis (strain HI4320) GN=caiT PE=1 SV=1
......@@ -9744,6 +9774,8 @@ MVVTPPSSAFRFSNLFKDHPDAVAAIACGGLVFLGWQMLNLGWLGIAFFVLTAAYVIGGFDNAREGLTTLFEEKEFDVDL
MSDYKDYLARQVMLGKMNRREFLGRAAALGIAASTANTLFASSAAAQEPKRGGHLKLGLEGAAATDSRDPAKALSQFMFVVGRNWGDMLVESHPTTGEPVPALAESWEPSADAATWTFTIRKGVKFHDGKELTIDDVIKTLQRHTDEKSESGALGVMKSIKEIKADGDKLVLTLTEGNADLPLLLTDYHLIIQPNGGTDNPDAMIGTGPYKVASFEPGVRATFERNADDWRTDRGYVDSVELIAMNDATARIAALSSGQVHFINRVDPKTVNLLKKAPTVEILNTSGRGHYVFIMHCNTAPFDNNDLRMALKYAMDRETLVQRILGGYGKVGNDFPINDTYALFPEGIEQRAYDPDKAAFHYKKSGHSGPVLLRTSDVAFPGAVDAAVLYQASAKKAGIEIEVKREPGDGYWSNVWNVQPFSTSYWGGRPTQDQMYSTAYLSTADWNDTRFKRPDFDKILLEARSELDEAKRKDMYRTMAMMVRDEGGLILPMFNDFVNAAGKTVKGYVHDIGNDMSNGYVATRVWLDA
>gnl|TC-DB|Q92NF0|3.A.1.5.17 PUTATIVE PERMEASE ABC TRANSPORTER PROTEIN - Rhizobium meliloti (Sinorhizobium meliloti).
MMESGPITGPVVTDATAGETALRSPDLSGVPAKPNPAADELGGTFWRRFAFRRPLAALILQRLGLSVGLLFAVSLMIFGGIEALPGDFATTYLGQSATPQAVENIREDLGLDRPWSERYLSWLGGAVQGDFGTSWASRNSVSEQIGNRLGNSLFLAFFAALISVPLAVGLGMLAVQFRNRLPDKIINVISLAAISLPEFFIGYLLIMFFAVKWGVATFPATVYDSMGFTERLSAIALPVATLVLVVLAHMMRMTRAAILNVMSSAYVETAELKGLGTFRIIARHAAPNAVAPVINVIALNLAYLVVGVVVVEVVFVYPGMGQYMVDAVTVRDMPVVQACGLIFAAFYIFLNMAADILAILANPRLRHPR
>gnl|TC-DB|PWA70598.1|9.B.311.1.14 TRAM/LAG1/CLN8-like domain-containing protein [Artemisia annua]
MEERTTATCYGTISNHATSSNQILWLFAVFGGMFMCKIAYELTAMISPLVFKGFIKLEDTKKLEWKNRGFSTFHAILVAIGSLYFLVISDLFDEHGNEEWIINRSSPYSDAILGMSIGYFLSDLAMILWTWPTLGGFEFILHHGLSMAAIVQALLSGQAQFYILIVLFTEITTPFVNLRWYLDVAGKKNSTLYVLDGIALFVGWLLGEMEGGSMDYNVSGLSVIGNHATSSKQILWLVSVFGGVLMCKICRTSDSLGFLICRVIDSEDIKELLAYLPAYEVTGVISPLFYKGFNKFNNTQKLEWKNRGFSTFHALFAAVGSLYFLVFSDVFDESNQKELIINRSSAPSDILLGMSIGYFFTDLAMIIWTYPTLGGFEYFFHHGLSLFAIIQSLISGQVQFYILIVLFTEITTPFVNLRWYLDVANKKTSALYMLNGLAMFVGWLFARIILFIYFFYHIYTHFDQKNLGWPLTGSEDPFRVYFSGEASLLSDGILHLVDDSTGISIDESALMSIGYFFTDLAMIIWTYPTLGGVEYFFHHGLSLFAIIQSLISGQVQFYILIVLFTEITTPFVNLRWYLDVANKKTSALYMLNGLAMFVGWLFARIILFIYFFYHIYTHFDQKNLGWPLTGSEDPFRVHFSGEASLLSDGILHLVDDSTGISIDESALVLEDH
>gnl|TC-DB|Q4A5Z7|1.A.77.3.33 Putative uncharacterized protein OS=Mycoplasma synoviae (strain 53) GN=MS53_0412 PE=4 SV=1
MSIKNNSKTKLKIFIKRNFDEIFYLSALFLVSTILLITIVFNYSSIIFGYLLSGLMIYLWNKYNKLFYYVFFQKVNFKYSKWVKIMIFLFLKKALVFITLGALIYFIVTIDVNAVINSEISGNKVIKFMHPINIFAFIVGIIINMFIYFLALYLHAKKNSK
>gnl|TC-DB|B2J0B7|3.A.1.15.13 Periplasmic solute binding protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_F4924 PE=3 SV=1
......@@ -9892,6 +9924,8 @@ MATLEIRAIRKTFTTPTGPVVVLDGLNMQVAAGEFVAVIGPSGSGKTTLFNIIAGLETPDAGAVVIDGNDVTGCRGQVAY
MAPLQAEDPQKYRLEEGDGTTHAQRIVRELYQRYERQLQRWKDYRNLFIFLCFVALFLGVLYEQRNAGISYQVHSTIESVAAPSDNIMQDTDAVYSWLNGLLTEVWKDPVCGDGLCEAPFEFASYSRFGCRADCGKLSEVQNLTKIQIDIYYDFSHPVGSIPASDLMQQASWNLCPLATAYSSDCYFDADKEFDRLSGVQNFVLDDAPDGDWNLVVRRDIFNKIRGAVRDTTLVYASAFYYKIYVAAAAARAEQAFEISLLNQAINITSQDFWTYANSVIMAGYPNATEYDAAVGWVKNATCFCDSVANDTVASGTPFTPEALMLYLNQSVSATDPNAPFSYTLTQYKNDPYYCASGPFDPREWRGRNVTVNSTAVNATANSTASSGNVTWTKELVTINMANQTALRDWCVGGLNLSIAWRTNMTNTVQRLLIDRRLGDQRTTGKIAQRNNVNDRMLAFIRANRPELVAPVFNAPRGTVALQDPINARLEYLYPLYVDGVKYSTEPQRAALNMTRRIVYNTTVHLLSLRPRAAARIAEVQEQIADVRAIALPTPITSYQNYTFPNATVGDVYDAFINAGATSFTVPAPTNSSLGAFQVSYNLVEWLGNTTAYMRCDLADRGAEYEGECVAMNNTCIATTNDTVPYNCTDLTNNGATITGNLSNPDYRMRCETPCDRRFDCNTICECYGTCAATEYCECDACIQLNVNAAADTQFVDIRSIVQDQAAASASIASIGLSGTVNRRASRRLLTTNEEIAAQLSNVLTQVGTVSTQQGSIATQMATLKAQVDRANQLAEARANDNRLIDLINAGRADIQAGQARVEAKLDEIIGKQNQALAAAEDAAKALSAIQGLAERQVAAQRALETAVTNQLSAIKTATYQSIITLTQALALWKRARRDKALTLKAAKLANVPCTSDPVSTNTFTLDNGNIVDTTTSRERNVGLTNRVIGGLLLHQTRTNETLCPESKFDKIQKTCTGPQTVASFGVDPIFKRGTTLYNPDYDDVNGTKVLDFYNCSVLSSPTYNVSFLNQTVNPAPYCAELYNPQELPYAFHFFPLSGKDDGFPVWFDINLSQDGAQTWFTYLQEGLYLDQNTRTMTAEMVTYNAPLRIFSYFYIKFYFSDGGSIKVTYRLNTARVELQNSYEDDVRFGFEIILSIWISLLLLINFWDIGNCQKTKGNFLKYFLSGWNWVEFCSNGLLFSCMVMWWVISSKYASKFEIPIRRDVYAGLSAEANFLALQSNGAWLNEANNDFEELKQLVDMFNWYFALNGINILLLIARVLKLMDFQPRLGVVTRSLWLAGPDLCHFAIVAGMVFVGYAMMGHLIFGNAIPAFATFGDAINTCFEILLGNIDVNSDLRALGGLQSVAGALWFWSYELLVYMVLLNFLLAIIVDAFSEVKEKTHETVGIHTELFQLMRDKWRSLLGSFSPNYISDAKLGDLLRQWAGEGDDKDDSPEVREEKRKLLTILNEDMDEETLREVFEECLRDAPAADPKAKQGNVLARLFKRNVGAGDTDATKKEIEQAAHYIVERFGAVPDDYDEDEDDDQEQLQAAPQQAIMGGGGMPAAPGAREAVLEKERDQLAQALERLAEVQRELAEGQRNLMSGQKQLAEQQSKLVQLMNETPPQ
>gnl|TC-DB|Q95X44|3.A.2.2.7 Protein VHA-8 OS=Caenorhabditis elegans GN=vha-8 PE=3 SV=1
MGISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRQKIMEFFEKKEKQVELQRKIQASNSLNAGRLRCLKAREDHIGAVLDEARSNLSRISGDAARYPAILKGLVMQGLLQLLEKEVVLRCREKDLRLVEQLLPECLDGLQKEWGSTTKVVLDKQNFLPSESAGGVELSARAGKIKVSSTLESRLELIANQIVPQVRTALFGPNPNRSFFD
>gnl|TC-DB|WP_049666291.1|2.A.7.1.18 QacE family quaternary ammonium compound efflux SMR transporter [Lysinibacillus xylanilyticus]
MSAFGFLFISIISEVFASSMLKLTNGFKRLFPSIGVVVGYGTAFYFFSLTLQSLAIGTAYAIWAGIGTALTAIIGIVFYKELFNLKKIMGILLIIVGVVILNLAGSGH
>gnl|TC-DB|P0AE24|2.A.1.1.2 Arabinose-proton symporter - Escherichia coli.
MVTINTESALTPRSLRDTRRMNMFVSVAAAVAGLLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAMLGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVLRMLRDTSEKAREELNEIRESLKLKQGGWALFKINRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWLSVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLDSIGAAGTFWLYTALNIAFVGITFWLIPETKNVTLEHIERKLMAGEKLRNIGV
>gnl|TC-DB|Q0P850|3.D.1.7.1 NADH dehydrogenase I chain B OS=Campylobacter jejuni GN=nuoB PE=3 SV=1
......@@ -11268,6 +11302,8 @@ MEGLLDPHYVCEPYEAIGAINDSLQPECFNGMKIEITKQHNENLVTGHYFTIEPPSPKGQKFNRIHSFLYSGYWGNIIAR
MATLTTTQTSPSLLGGVVIIGGTIIGAGMFSLPVVMSGAWFFWSMAALIFTWFCMLHSGLMILEANLNYRIGSSFDTITKDLLGKGWNVVNGISIAFVLYILTYAYISASGSILHHTFAEMSLNVPARAAGFGFALLVAFVVWLSTKAVSRMTAIVLGAKVITFFLTFGSLLGHVQPATLFNVAESNASYAPYLLMTLPFCLASFGYHGNVPSLMKYYGKDPKTIVKCLVYGTLMALALYTIWLLATMGNIPRPEFIGIAEKGGNIDVLVQALSGVLNSRSLDLLLVVFSNFAVASSFLGVTLGLFDYLADLFGFDDSAVGRLKTALLTFAPPVVGGLLFPNGFLYAIGYAGLAATIWAAIVPALLARASRKRFGSPKFRVWGGKPMIALILVFGVGNALVHILSSFNLLPVYQ
>gnl|TC-DB|P39843|2.A.1.2.8 Multidrug resistance protein 2 (Multidrug-efflux transporter 2) - Bacillus subtilis.
MKKSINEQKTIFIILLSNIFVAFLGIGLIIPVMPSFMKIMHLSGSTMGYLVAAFAISQLITSPFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFSRILGGVSAAFIMPAVTAYVADITTLKERSKAMGYVSAAISTGFIIGPGAGGFIAGFGIRMPFFFASAIALIAAVTSVFILKESLSIEERHQLSSHTKESNFIKDLKRSIHPVYFIAFIIVFVMAFGLSAYETVFSLFSDHKFGFTPKDIAAIITISSIVAVVIQVLLFGKLVNKLGEKRMIQLCLITGAILAFVSTVMSGFLTVLLVTCFIFLAFDLLRPALTAHLSNMAGNQQGFVAGMNSTYTSLGNIFGPALGGILFDLNIHYPFLFAGFVMIVGLGLTMVWKEKKNDAAALN
>gnl|TC-DB|BAK14282.1|2.A.18.6.23 probable amino acid transporter [Red seabream iridovirus]
MAPCVLQCGVTDVFLHTLNCMIGIGLLALPHAVAVVGPVVFVGVLLFVAVAAIVSTHMLTACLRTHRGNLEDICAAMFGRGGYWIMCAVIILENLGSVCSYMHMLMSVLAVLVPDISMYYAVGMLILLVLFPVSLPKSSRCLMIISGPALMCVLAFVVYTIYYCVHATVPGPAWPLFDDRMRVDQCLSIITFAFVCQPTIVTTANLHGDKASGAAAAAMCAMSVGTVLYAVIALCGWLPMGPETPDNIVLAYMATLDGKIVAGVMCVSVVLTVPALLLPVVHMMAPIDRSPMQWMSTLGMYACMYVLVIMIPSFKIGVVVVGAVAGTVLVFALPALMYTWLFYRRRVLAWMVVVLYTTIGIAVSVMAIYDIKIQLQGY
>gnl|TC-DB|P39850|8.A.3.2.1 CAPA protein - Staphylococcus aureus.
MESTIDLSELLGRVRKNMKLLIILPLLGLLISAIISFFFLDVKYQASTQILVNQKGNDSQIMAQEVQSNIQLVNTYSEIVKSPRILDKVSKELDDKYSRSEISSMLTVTNQAESQVLNIDVESKSGSNSEKIANKIAEVFSDEVPDIMNVDNVSVLSTADNTGKQVAPKPMVNLVVGLVIGLVIALLIIFIKEVFDKRIKTEEEVENELVIPVLGSIQKFD
>gnl|TC-DB|P0AAD8|2.A.42.2.2 Threonine/serine transporter - Escherichia coli.
......@@ -12042,6 +12078,8 @@ METNVEKNSGTATEKPSLFGVITSPSVQFERIRERPAVWGPLLIVAAIIIVGAVLQSLGTDYSELLKSQDTQGLSAEQME
MAGRIAFGSSWLRIEDTGVFGPGRAKIARRFARRVFTLPEVESLELEPSRGCALIRHRTAKTGVDAFRRRLAAAVDVEEEGRADRDLPQWPADSPVTLHRHDDLISLFRIGSAANGWLELQHPSLQGNAVRLRTIEAALGALDAVRGVSGHAASGTIRIRYHAGSLEPAALLRVAEGLLIAETASCIPEPAAVDFRVANASVGLGAVGELMLPLATPLAAGLLVAGNLRVLQDAGKQISHGKLGVAVFHTALLACSIATGQVLAYALTEWSLRYWQQNWRKHLTRETRALLEDNLPIPAQTVLLSPEGIESRVAPSDLRAGDRVKVSAPRIIPVDGVVLAGQALVQESSLRGRPGLVRKTAGDEVLAGTVVANGSLDIQAVCTGPETRAAGLTRQVLDTASLMPADRTMRRRAEELADRTVFPTLATAGVGWAVGDLITVGAILHQDWVSGPGMVLPMETLRAMRLAWRAGALLKSASALARMKYSDFLVIDGDLPGLLDPQLELAEVASQAPYTDTILRHAAGAGLFLGDERAEALARSCAQRGLVVREPELLSLDANAVEVRSGRHTVSLTGALSHSEAVTAPLRMRIDGTDVAELRFTYSHRPRASQTLASLRALGMRQIFVVSSRPEAETAELMRRLGADLSGGGLNAEQKIRFLRGLKNRGVRTTLVGDFDKESEMAGEAHVTVGLVNPLGDSGPCDIALLSESLDPLVALMELARSHDANVVSACRMAAIPNLLCIAGAFAGILNGITSGIIANLGVVNVDRRLRRNLQMAKGASRSASALNKPGARRSPEPSPPVLLIGMKHLIPAMPPSHYEAEQIRAIAAWKRRKPHLASPLLNRARRPLVRLGRKIIPAPASRFALDALNKMAEQLVRDDWILRHGGIRSLEEIGAQSLEFSDRLADKVIEEGLKLATGVGAVTGTGSLGTVLVGVPASLGVALRLIHRVSQAYGYSTERTGDRGFMLHILALATAETAEERTRALENYHWQLEHHLVGDAVNDAALAVLQRIVFGRKLASFVPGLSVALNAYANRSFSRRAGLAAKHVYQERWLLDRGRIAGWVAPT
>gnl|TC-DB|Q6F754|2.A.15.1.9 Putative high affinity choline transport protein (Bet-like) OS=Acinetobacter sp. (strain ADP1) GN=ACIAD3460 PE=4 SV=1
MPSKTSSRFANINPNVFVSTIMIIAIFLAIVILAPDAFELLTQQLKNWITESFSWFYVLSVAFFLIVLGYIACSSSGKIKLGPDHSQPDYSNSSWFAMLFTAGMGIGLMFFGIAEPIMHYVSPPSGEPETILAAQQSMRVTFFHWGLHAWGIYAIVALSLSYFAYRHDLPLKIRSSLYPLIGKKIYGPMGDAVDTFATIGTIFGVATTLGFGVTQISSGLNYLFGFEPTSFSKVVLIIIVSAMAALSVGLGLDKGVKRLAELNLVLAVTLLAFVFFTSATVYLLQTTIQNTGQYISNLFEMTFNLYAYQPNGWIGGWTIMYWAWWISWSPFVGMFIARVSRGRTIREFIIGVMLIPTGFTLIWMGFMGNAGLYSILHDGNLSLLNAVQRDSSVALFEFLHSLPFSGVMSLLATVLVVLFFVTSADSGALVVDYLTAKSEDSPVWQRLFWIVVMAGLAIILLLAGGLTALQSATIMSALPFTFIMLLICWGLIKALRIDSTKMQAIQEARTTPRAIQNPRSWQQRLGLIMHYPHSKVEVDAYIKKHVQRAFESLEREFKRRHLTVAISETDDGLQLKVDHHDEINFIYHVVSRETMPPSFMLEQEHNADVEKYFQAEVFLREGGQNYDVMDWTEEDLIQDIIDQYERHLYFLSVMRAQTGN
>gnl|TC-DB|Q9LY32|3.A.3.3.12 ATPase 7, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA7 PE=3 SV=1
MTDIEALKAITTESIDLENVPVEEVFQHLKCTKEGLTSNEVQERLTLFGYNKLEEKKESKILKFLGFMWNPLSWVMEAAALMAIGLAHGGGKPADYHDFVGIVVLLLINSTISFVEENNAGNAAAALMAQLAPKAKAVRDGKWNEIDAAELVPGDIVSIKLGDIIPADARLLEGDPLKIDQATLTGESLPVTKNPGASVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTTHVGHFQKVLTAIGNFCICSIAVGMAIEIVVIYGLQKRGYRVGIDNLLVLLIGGIPIAMPTVLSVTMAIGAHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFKRGIDRDMAVLMAARAARLENQDAIDTAIVSMLSDPKEARAGIKELHFLPFSPANRRTALTYLDGEGKMHRVSKGAPEEILDMAHNKLEIKEKVHATIDKFAERGLRSLGLAYQEVPDGDVKGEGGPWDFVALLPLFDPPRHDSAQTIERALHLGVSVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLSDNNTEGVSVDELIENADGFAGVFPEHKYEIVKRLQSRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLCVFWEFDFPPFMVLVIAILNDGTIMTISKDRVKPSPTPDCWKLKEIFATGVVLGAYLAIMTVVFFWAAYETNFFHNIFHVRNFNQHHFKMKDKKVAAHLNEQMASAVYLQVSTISQALIFVTRSRSWSFVERPGFLLVIAFLIAQLVASVISAMANWPFAGIRSIGWGWTGVIWIFNIVTYMLLDPIKFLVRYALSGKSWDRMVEGRTALTGKKNFGQEERMAAWATEKRTQHGLETGQKPVYERNSATELNNMAEEAKRRAEIARMRELQTLKGKVESAAKLKGYDLEDPNSNNYTI
>gnl|TC-DB|Q9WXN4|3.A.1.5.16 Oligopeptide ABC transporter, ATP-binding protein - Thermotoga maritima
MSRLVVKNLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVGSIPKLYRKLEDL
>gnl|TC-DB|O06742|2.A.1.32.1 YITG PROTEIN - Bacillus subtilis.
......@@ -12598,6 +12636,8 @@ MNLGWTEILLIGGIALLLFGPSKLPNLGRSLGESIRGFKKGLNEDPAADEKEAKQQITQNPQRPVNEQQPQTEEKKETHN
MRFLSRIYILNNDKSLLVYPKNVKKLMSKIKSNFSFTELKRNMGSKSLIALITVNTLISLFFIQGLRGFFPAIRIALFHVVFGEDVMVNFLPLLALIFLFFPGFTNTISKKIDKNRTMIFSIYAILIVRLIWAFHLPGNLETVYSGLIIMFYGFYLSTFLTTWIEERGDIKANQKMIIAIFSFFSAFLIDYLIRSIGFSQDISLIAPGLIADWRITQYIWLIIQIPLTILCIYLIKVHLPRFSTKDNTISQEKGKENKLGTQYSLIFSGIGMFLFLLFNLFLYPNGIGQFTDTNYFFNNIINIVSVMVAIYVLLYVKMEVISNRNIIIILNGFMILSLWVFFTFGKVLMYTASILISISLIIMYLNVYLLFSRLSKISFKWEKVKTISNGITIGFAFMILFSFLHAFTTEWAAILAMFKDLGSLIMIIAGVIFSISTVCAVLIKTKEEVKER
>gnl|TC-DB|Q5LMY2|1.B.7.1.6 Outer membrane porin OS=Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO3430 PE=4 SV=1
MKTEGNTMKKVLFATTALIATASVAAADVRISGYGRFGLDYNDANDRAVNGVSKTTITSRLRLQFDMSAETDAGVAFDARFRAQAESRDNTPGGATFNGARFGVSYQGFRVNVGNIIGAVENMPGTYLETRTAGIGIDGASFYSHVGNVNNEFFNWDAYSSAGTGVNGIEAIYSTGGFTGHLSYSTRNGAVASDRIGVMLSYNFGDWTVAAAHQSSDAMWEDKTLVSVAWDGGQFGARVAYADNDGISKFGIYGNMDIGASSNILLFYTDEEAVSASDVLAGRGDNRDAVAGSNMNEGGSYGIHYSYDLGGGASFEAGYRRASNDNDTFQAGVYFSF
>gnl|TC-DB|XP_005506857.2|9.B.311.1.8 protein CLN8 [Columba livia]
MNPTNDDPVFGTIFDWDYLLWEVRLTFLAAGFFIYLGVFLLSHWLSSRISTTYRALHAKEKVFWNMAVTRGVFGLQSCVSGLWALLIDPVFYADKVYSQQKWSWFNCLIAAGFFLLENVAVHVSNVIFRTFDVFLVVHHLLAFGGLAGLVINVKSGHYLPLMGMLLEMSTPSTCISWMLLKAGCANTLFWKVNQWVMIHLFHCRMILTYHMWWVCIFNWNSVIENLGLLHFIVLFSGLFAVTLILNPYWTYKKTQQLLSPTDWNFENKATENGNFNGETHRKKRI
>gnl|TC-DB|E4VH40|1.B.31.1.3 Putative uncharacterized protein OS=Helicobacter canadensis MIT 98-5491 GN=HCMG_01600 PE=4 SV=1
MKFIKLSLAASVALGALSTASFAQPLEEAIKGIDVSGYLRYRYNDDRYNDSTGNAAHQWRAVADFKTPVVNNVALNFGVWYQNENNVNHGKGTGNETPGTAQAFTGSGLGSGSDGQFGVREFYATITPDSTATTIKIGKQLLDTPVTNAYDRDRGTGILALNSDIPNLTLAAAAFDSWSINEVNAQNQINNAGGVVTNNGGGSLINNGLSNDYSIDKPLYALAGIYGIDTNYGRFGGQLWGFYIDDTVDALVFGELSWQGSLLRAKLQYSFAALNNDSDSIFAGLYGYGTANRNKANISEANDAFVVEVGADFRNDFQLPLNVALGYITNFADGTAVALEDEGSNVSRKGKIWWQNAGTGISTSVLRGYGVQGFGTEQDIDVFYAGVDYSFLDERLNVGLEFAWGENDISYNRVAAANNNIIKKVEFTEITPTITWKHSKQLTLSTYYAFLKNDYTYVTPVAGQDQDRDRFRVEAKYSF
>gnl|TC-DB|I6VBE8|1.C.3.2.5 CctA OS=Clostridium chauvoei GN=cctA PE=4 SV=1
......@@ -13242,6 +13282,8 @@ MLQRFRPLLLSPILAIALSFSTFPLISQEKPEASKDQQPPKVAETKEVTSSGKEPSNTNVTNPNPTTTGTVTAPSENKSN
MNLSDTFPPLEAPAPAAVRPWSFPDHARPVPDRRATFAVMLVGTLLSLALSGYAAGEENNYYQMPILAGLYHEPQFATDPFIQSLRFYASGFWQMLSGSANGPHVYTILFAFQILSRMILVFSIMEWATLLECGSVMEVATFTALVLLSSTIRGFSNAGVGGLLISSFTHSEMANGTMLLALVWAGRGRITASLAVNGVTFFLNAFVGVWTLVPLVFIIWSHWRHHGVAGRTLARQAAWGVGILAAFAAPVVHNILANPYTREAPSFDYVGFLQSFFPYHFLIWSTSHREQGLLAVIFCCGLATASMLPTSRAALKAALWGAASVWIAGVFLPFLSHSRLLLNLHLLRSGSTVHMLSAIAVAALATRWVFSGTASDRLVWAPLLFVLSCTLKIFMPLVLVLLVVRRWRPAVAVGLRRYAAPALLLAGVAFNVALIYRAAVSSRVAVQKRDDWQALGTWARAHTAVDALFLNPPGISWGMGMSAKNDAFQDGLSEGAPVFTYFSHRQSWVSSPAGAAVMWAPAYYPTWHARITEVRALKTLPDRLDYAARNGIAYVVDGCARTDPRPPLARFGRLCLFSSRSTQS
>gnl|TC-DB|R1C491|1.A.17.3.6 Uncharacterized protein OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_451393 PE=4 SV=1
MHAGQSAPERGDVPGSQLPSLRERRVAATREGRSLLLPSTVGAPNAPPPPADILEQRQRMVAAANPALSQPAGAVAGEESGEDDAQSLASIPSPASSAPPSPQRSATPGRPADTPSLGDASNLSGAAGGEAAGGEAAGSPAERERSSSSLIETSAGLLDSVSSMLAGYAPWSPGKGRRGATRASAASCSVPTSPAASASPSIVRPAGSVAAARRFATKTRQPPRDGGGSGASPQPSALDREFSLRRGVSPTTERLRAYSGASGAHAKARWRQYVRRKLLNSEDEAIMNAALMSDISGDVAELIQDTTPFTARRRSEGDSSSRPASREASRRRWSEGDGRLRSPLTVEGSPEPGFAPPSYEEGAATPPGRAAAKAAPLDAEAVHVDVGPASPEPEAGGRFPLCRRWCLPRTRPSHHARREPGDIEGKLRDKEMEGSALAHTLSIGHGMHAPPSPDMKKARLYASQRLARQHEGDEAPGELYPLYTPLETFDRFGTDVSQYMHFVLYTSRLFFCLFAFNLANLIINLEGQNLAFLELDSAAAGVNPLAVVHTLGNTESTGVLAKGGHSYGVIEFITSGVLVVYIFWLRGKMSEIRTRIRNSTSLATLTAADFTVMVSHLPDGWGSDDVRGFFERFGQVVHVSVSLNNRGLILEMKRTQELRDRHTEAALHLLTKMSRLAKKEEVVRARVRSVRSLERFERHRARLRLLMRGKYQHTGHAFVTFNKASVTPELVRRLGKGGTDEHRALGAKLHVKRAPEPSDVLWENLQYSRRQQRQWQCLSTGIMCVLATVGIFTIFVSNYYLAPGVNPNAAYPLPAGQFLAQMLGALVVNIGGHLIFFILVLFLAKLVEVQYTHREREKEMMIKMTVFQILSVVVPSFLYLFLNTNANELAFNDSMGRFGASWYVSGGQFVIVALVGDATAINLFIDLVRPVPDLFNRYVLARRAKTQAKMDELWTIDADLTLGFRVQLMNKIVFVGLMFAFAIPILYGLIFLFLFSAHWVDRYTLLRRLTPPPVTHDGLMEVVIRYIFPVAVLTHTVMAVIFFNDICVGSKAADEGACERAFAAGFSFDNSTNSSDLLGGTCVPDVGTGDLNDLLDPERIAVKEEWAEHIRNNANFDLYSGSVLSLECLVANASQSGAFCTVVSGCSLELSGAHVILICGAFIWGIGVVVYLLLHWCKRRRDAALGEKRRSALSTFSLNAFRFIMQRDAPMYLPPLTRALLEMYGNNARLDRRLLKSYLQIANVPIQQGPGGSVEELRRSSLSSERSVLSSLAEPLREASGRVKGTVPSVEQVRTMRDALRQKLGEVEQQLSAIGDRETYQQSNTALRGGLQRGAQRLGSTFLRRKSDPRFSESDISEPELAPPFSPVAEEDPEGLAVDVPGDDPEGLAVDVPGDDPEGLAVDVPGDDPEGLAVDVGRAPTTDEKYLSSRLSNADFS
>gnl|TC-DB|OCL09642.1|9.B.311.1.3 hypothetical protein AOQ84DRAFT_388040 [Glonium stellatum]
MQDPIPPAVWVREFFEPVGRLCNLPALPNHAHQILISLLFYTCAYKIAPSLFSWLFPSRYGSLNKAKRHECHVDAVSLTQSTINSLMAVVMLYFDTDRKDISWVERVWGFNEGNGLVMAISLGYFIWHFVMMALHVHHYGRMMLLHGFAACFVVLYAYRPLLIHYGPIFLVYEFSNPFLNLHRFFEKFGKHGTQLQLINGIILIVVFFFCRIVWGTYHVSWLYRDMWAAVRITDENLAAYQRTLAASQGHGSSIIYVPQRIPAYFAVVHLGCNTTLLLLCYYWFCLILRKAASTLFPTAKNHKEGGSAEKPSVVMTRDGRRSD
>gnl|TC-DB|D3E1Y6|3.A.2.3.2 A1A0 archaeal ATP synthase subunit I AhaI OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / M1) GN=ahaI PE=4 SV=1
MFRTARMRKLNVITLDKYAGPTVSALHDEGIVQINDISERIQQDPKLAELLKPSKVTPYTGKLSSLLMKTSALSDLLGDALSEGQSLKDTLMSFISPDLPVPKEVEDVDTESFIAYAESTLSQVEAETKGIEDKLAALDSEESKLESNKSLASKLKNLDMDLALLSDSKYTSTIVGRITAESAQKFKSEYSKITEDLFYELVPDDEKEYNILVVVVANEFKDDIYTLLRKNEFEKFETEDLQGRPDSLISSCESRLQAIESERSQAKADLKVVAEKWDDEVLALKEQLENEKEKNEVFATFAETDKTVVLEAWVPEKNLEQAQSIIETATDGHVIMETEEVPDNAEDVPVLQENCTYAKPYELLVEMYSPLKYNEIDPTLFVAITYPFFFGFCLTDAGYGILVALIGFILYRGMGKVNRTMHDGGLIIIASGIWSIILGLFTNGFLGDMWTRILGLGPALPTVIDSINAFKFPATILVIAIVIGIIYTNIGFILGAIDNLRYGEKKEAIGSQIVWFVFELGIILLILGFLFPTFGMIGMALGAVLIIAALGMLIWANGAYGLMDVFGFMGDVLSYARLLALCLATGGIAMTVNILTNMVNDMIPFVGIVLAIIIFIGGHIANFLFQVLGAGVNALRLNYVEFFSQFYMGGKNSYQAFKAKRQFTKVKK
>gnl|TC-DB|O31809|2.A.3.9.4 Spore germination protein YndE OS=Bacillus subtilis (strain 168) GN=yndE PE=1 SV=1
......@@ -13846,6 +13888,8 @@ MQIINLMKKDLLVCKKYYIFSMIYIVTFGVIFNEFGMLLFIMCAVGINYLISNTSMAFDDKYKADIMMNILPVSRKDIVL
MSGQDPNSQSEITKHDTGWRRVVRHFTPSWFSVTMGTGIVSILLNTLPYNGQWLYWISVVCFAFNVLLFAIGCIITFLRYTLYPEIFFAMIKHPVQSMFIGTFPMGFATIINMFCFVCVPAWGDWTRNFAWGLWIFDAIFSVITALSLPFLLMAHGSEMQLSSMTAVWLLPIVSCIVAASSGAIVADVLPDPQHALWTVLVSYVLWGIGLPLALMVMVIYLQRLTLHKLPPKAVIVSVFLPLGPLGQGGFGIMKLGQAAQEIFPKTQTLEAASGPIFYTMGFMIALILWSFGLVWLFFALASIARSKSFPFNIGWWGFTFPLGVYATSTCQMGKELPSEFFRVLGTVDPKRKARFGWNGGMILIQGYGIPVLLTPRYENQYTQGRDSLGTLE
>gnl|TC-DB|B0STR2|3.A.3.27.2 Putative P-type ATPase, copper transporting ATPase, a phophatase-like domain OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=LEPBI_II0058 PE=3 SV=1
MNKTNSQSTTTECDHCGNPIQLIRIESKLGDEPKVFCCEGCETVYSIIHSLGGSYYYNLKGNTKLSPVAMEETDVDLENELVYQKFVRPSSGHSEVSIQITNIHCSACVWINEKVLNEEEGILSAQINFASGRARIRFDESKIKISRILSLIRAIGYKPVLFSPTEGNLQKSKQLKTLLLRIGVAGFCFGNIMILSVALYSGYFTGIDLNLKRMFHYASWVFATPAYLYSGFPFMSGFLTSIRRRTLSMDFLLFLGISMAYFYSVYVTLTDRGEVYFDSVAMIYFFILVGKYFEEKARVFASDKLESILCKLPETSNRITETGDQTIPSSEIKLGDKIQVAPGKRIPVDAILVSKETYIDESFLTGESVPIRKQKGDSILAGSLTMDNPALIIASSDYHASTLSSLKLRLEEALHLKPKIQIVTERIASYFISIVFLLAFVCFGVWMFLTSGDLEQSLVTTISVLIVACPCALGISVPTALVTNHILNAEKGVLLKNPSVVETLAKANTIFLDKTGTLTEGKFLVRLVTVSEDHLPFVYRIEKEINHPLAKSLVKYLSPFDSVKKRASEMELIQLQNVPGQGVKAEIQWHGKEYSILIGNQTLLKHQNIPLESIPETEGSLILVAINGKMEGSFLLADEVRPGALSFVSLLKEMIPKIAILSGDRFSAVKFIANSLGIQQFYSDLSPEEKASIIEDSQNKGNVVIMVGDGINDSLSLARANVSISHSEAEDLSLEKSDVVLTSGNLNGLVHSLLSAKKTKEVISQNIIISFFYNSIMLPLAMFGLMLPVICAVFMACSSLTVLLNSLSIRVRIPKWKPSI
>gnl|TC-DB|EJY66856.1|9.B.311.1.26 hypothetical protein OXYTRI_12852 (macronuclear) [Oxytricha trifallax]
MSGSQEAYVTTLEIYILIGIYFSSIFGFLAIYTSIQRSLELNGQKDPRELSNYMKEYVTWTPQQKADFISRITSQMHAFLSICLAIKALFYTCVEPGHESEGYTNFFQSDYCLMKQTSVWQLLTLCFTAGYLTFDTYICYTKIQEHSKMQTQTYIHHATGITGFICAIIYGPGGALIISNVLLINELSTFFLNYRQFFLVFKKTSSPWYKYNAVAFLFTFLFARIVFNTIVALWIWKALYLTIKNNGNGMFDIPLWKLTVGLYLIGLFVEKSIIKQ
>gnl|TC-DB|P13866|2.A.21.3.1 SODIUM/GLUCOSE COTRANSPORTER 1 (NA(+)/GLUCOSE COTRANSPORTER 1) (HIGH AFFINITY SODIUM-GLUCOSE COTRANSPORTER) - Homo sapiens (Human).
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA
>gnl|TC-DB|P36500|1.C.21.1.4 LANTIBIOTIC SALIVARICIN A PRECURSOR - Streptococcus salivarius.
......@@ -13856,6 +13900,8 @@ MTLLCIVGSAYATSTNLSGITTSKLSDNKKLPCNEVGIKILFILLLVKLMLNEIKENLKYVKSTLKFIGSIVLLIGVVYY
MTRPTWDADDHEPSAKHDERGRSEGGATARDVIAHNPNPDRHGRWLSASIVVLGAVAIVQAAAFDIVAGLLWNALLVGAALIATGAYNYARRADAEFGSVGVAMLTSVLGLWLVASPFVIGPETGTVAAANELSATITVVVGLLVVGIGSYSAVTARARRGDADARATAVYDRRGQ
>gnl|TC-DB|Q2KCS0|2.A.115.1.3 Hypothetical conserved protein OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH00548 PE=4 SV=1
MASNVFTGLLNSSADRHSLFDDAQGIVAGSMLAVLGVSLLSGAGLLAGGTAGLAFLAHYATGFSFGLCFFAVNLPFYYLAFRRMGPAFTIKTFAAIALTSVLSEFVPGFIGIGQVDPIAGALFGGLVIGAGVLALFRHRASLGGIGILALYIQDRLGWRAGLVQLGFDCLILALSFLVASPAIIACSVLGAIVFNLTLAINHRKDRYIAV
>gnl|TC-DB|XP_001703000.1|9.B.311.1.18 predicted protein [Chlamydomonas reinhardtii]
MAFGLLGAALAPGLAEPGSALGLWDFSVAGWVALLLLLLRRVYDITFTPWLARRLLARPADGTILGAEAVEPACDVAPSPAGPVARTWDSASERDEEEKAEDVPTAVPAGGARLRRMVPRGDEVMAASSPGGKPATAAATSSTPAPAAASVDTETAEAVHKRAAATADSMWIAALNLALVLGAWWVIATHNGGCTPWSTWDCFGHWPNHPVMMSQRWYIVLSFAYYLYELAGTVLGCGTKLKNDMVAHHIVTMALLVLGYVTNIIRMQVTWQALFDISNPILHTAKALNASGVKAVARLKWGVFILFALSFLVCRVLAGPYSIIWPSFTVAPQWLPPSLCYPCWALMIFVYILQLIWFYKIVEIAVKGDKAVRKHTAVAKR
>gnl|TC-DB|O75143|9.A.15.2.1 Autophagy-related protein 13 OS=Homo sapiens GN=ATG13 PE=1 SV=1
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
>gnl|TC-DB|WP_080739295|9.B.290.1.3 hypothetical protein [Rhodococcus fascians]
......@@ -15080,6 +15126,8 @@ MSLSSSQARQLWIPVGLAVAVMLPALALRIAGWRPNPVLDIGVFGAAILAAGFLLSWGAEAAEKYLSQGLILAAVALVTV
MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCAIGLFLFYLYQGIYQCYPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEMLLTFAYHDTPIIIVNALLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSGTIDPHNLKPVLANGISPVLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMAISGLIVALTVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFFKVSLYLYATVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYIHLPFQLLFPLFLFIVAVWKKKRREKSKGEEAKK
>gnl|TC-DB|Q5SI73|1.C.113.1.4 Putative hemolysin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1501 PE=4 SV=1
MVREPFNALSHALGVPLALLGGLLLLLLAPREAWPALLAFGLTMALMFGASALYHTLKAEDRLLAWLRRLDHAAIFLFIAGSYTPFLAEGLEGGDKALALALVWGLALLGVGFRLLYLKAPRWLYTLAYLALGWLSLFFLPRLHLPLPTLALMALSGLSYTLGAWVYGTKRPDPWPGRVGFHGVWHVLVLLGSLFMYLAVLSLYT
>gnl|TC-DB|WP_097928324.1|9.B.309.1.3 DUF2177 family protein [Monaibacterium marinum]
MDASLTTYLTLYAVTLAVFLGIDVIWLKLVVRHLFESRIGDMMRDQPLIGVAAGFYAAYVAGVLYFASAPALDSAAYGEVFLRGAILGLLAYGTYEFTSMSVMRNWDWTMVAVDTTWGGVLTGFSAVAGLWITRLIG
>gnl|TC-DB|P48613|8.A.19.1.1 TipE protein (Temperature-induced paralytic E) - Drosophila melanogaster (Fruit fly).
MGDEQDKRTGKEKLLFYTTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYYGAKNCSWSSCREGCTKDIYTCTQIRVNYRLNLYNFTDEFNFTEYHINLKEAERILPPVKRTDRYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISDERRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRYTKIGMKFPCYYSKVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAYFKIYNEDEETAPLDKNAEDMDIDDIDAVDDSDGAVLADNVAGSQIINMDSTTNDSCLEGVLPNGGPGMTASISQGGSVTTPGPYIAQSPAGSQMTPNSEINSFGHQLKVQMADELSRDSLENGAISTSNSVQGNLSKTMTTSISTPPGPTAAV
>gnl|TC-DB|L8JIJ6|1.C.87.1.3 Uncharacterized protein OS=Photobacterium sp. AK15 GN=C942_02751 PE=4 SV=1
......@@ -15252,6 +15300,8 @@ SDSSLSKNSIRDRNSALNKIFENFNNLDDVSVITKDKILDNLNSIKFKTKLSAGVNAIRFLKEHNLDVDFPSEDELKEII
MNPMQKKKLISIAIALTLQSYYIPAIAAENNDDEKECPSNISSLPKEKRAKLSPTCLATPENDNHWGWVAGGVAALVAGVAIGVENNGGGDSNHSYTPPKPDNGGDVTPPDDGGNVTPPDDGGNVTPPDDGGDDNVTPPDDSGDDDVAPPDDSGDDDVTPPDDSGDDDVTPPDDSGDGDVTPPDDSGDDDVTPPDDSGDDDVTPPDDSGDDDVTPPDDSGDDDVTPPDDSGDDDVTPPDDSGDDDDTPPDDSVITFSNGVTIDKGKDTLTFDSFKLDNGSVLEGAVWNYSEQDNQWQLTTADGKTLNVTGWDVTDANAAVIEGTQENGLYWKYDSRGYLIIADDNTTVISGDDQAHNSDRGMDISGQDRTGVIISGDRTVNTLTGDSSVTDGATGMVISGDGTTNTISGHSTVDNATGALISGNGTTTNFAGDIAVSGGGTAIIIDGDNATIKNTGTSDISGAGSTGTVIDGNNARVNNDGDMTITDGGTGGHITGDNVVIDNAGSTTVSGADATALYIEGDNALVINEGNQTISGGAVGTRIDGDDAHTTNTGDIAVDGAGSAAVIINGDNGSLTQAGDLLVTDGAMGIITYGTGNEAKNTGNATVRDADSVGFVVAGEKNTFKNKGDIDVSLNGTGALVSGDMSQVTLDGDINVVSVQDSEGVFSSATGVSVSGDSNAVDITGNVNISADYGQDDLAAGAPPLTGVVVGGNGNTVTLNGALNIDDNDLSATGGQYLDVVGLSVTGDDNDVEIDGGINITHSEDPLDGTSADITGISVSGNSTVTLNGHSTIDTNTVVGGHVVLARVNNGGSLILGDDSVVDVNVSYIPTGYYTYNALLMADGEGTSIENKGDITSHGVYSVIRADNGSEVSNSGDILVYATSSNSSEDRAAITRASGEGSAVHNKAGGDITLISDQTPQGSGGIEVYPLKWYTHTFYAMMASDYGDVVNDEGATIHLQGAGVYGVTASRGKALNEGNIYLDGLVPTLDDENNITSTSYWQPSSLYLTSSGMVAGSTDADGDATAINTGNITVNNAGFGMMALNGGTAINQGVITLTADDGVTGQADELVGMAALNGGVVINDTSGVINIDADYGQAFLSDSSSYIINNGSINLNGSPMDDTDSHMGGTPTDKIWIQSLPGSGDSDTRTSDTGFFTAGTLANYGTETLNGDVDVNGGWLYNEAGASLTVNGTVTINGGANALANYGTLDADAISTWHSLFNEADGSITTDLLTLNGDVTFYNNGDFTGSIAGTSYQQEIVNTGDMTVAEDGKSLVSGSFYFYNEEDATLTNSGSAVEGGENTIINLTRANDSLTQVNSGTITATNGYSAITTVNGSNDPKWIWNTATGVINGINPDAPLINLGRGYNFGNQGTINVQGDNAVAISGGTSSYVINLVNSGTINVGTEQGKEDGTNGTGLIGIKGNGNATTINNTADGVINVYADDSYAFGGKTKAIINNGEINLLCDSGCDIYAPGTTGTQNDHNGTADIVIPDATTAPTEGSIPTPPADPNAPQQLSNYIVGTNADGSSGTLKANNLVIGDNVKVDTGFTSGTADTTVVVDNAFTGSNIQGADNITSTSVVWNAQGSQDADGNVDVTMTKNAYADVATDSSVSDVAQALDAGYTNNELYTSLNVGTTAELNSALKQVSGAQATTVFREARVLSNRFTMLADAAPQIKDGLAFNVVAKGDPRAELGNDTQYDMLALRQTLDLTASQNLTLEYGIARLDGDGSKTAGDNGLTGGYSQFFGLKHSMAFDEGLAWNNSLRYDVHNLDSSRSVAYGDVNKIADSDMRQQYLEFRSEGAKTFTMMGDALKVTPYAGVKFRHTMEDGYKERSAGDFNLSMNSGNETAVDSIVGLKLDYAGKDGWSATATLEGGPNLSYSKSQRTASLQGAAGQSFGVDDGQKGGGVNGLATIGVKYSSNDTALHLDAYQWKEDGISDKGFMLNVKKTFR
>gnl|TC-DB|O15554|1.A.1.16.2 Intermediate conductance calcium-activated potassium channel protein 4 (SK4) (KCa4) (IK1) (IKCa1) (Putative Gardos channel) - Homo sapiens (Human).
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
>gnl|TC-DB|OLS26559.1|3.A.1.125.6 putative ABC transporter ATP-binding protein [Candidatus Heimdallarchaeota archaeon LC_3]
MTTKAESPQTSVFSTMLISKPHRRANYALRRRLLLIMKQPRLSWMNLEGYDIFTKIIAVLGGLILALVITNIGSGINYGFHFITGDIDQQFQWFEITGNSLPVILVLFIIGAFLTNKTFQWWVDRPVGTVAELNTFIIAQMQPLSSKFEVEEERIKYETKIQMAHRKYKRKLLKQLQSHIANDFELKNSRKILVDVAKSLKSSGTKEEIKAEVDEVLDWAWSTLDHVHKGSRLTYWDNVSGIDRLIISDHLNQKQLIEIEAEAEGIVDELNLLVFANRYSSVMLPLLQQSVKFSKAFEEHCCTPKFVETFQKGEKHDENFAEAYRVLLSKSLGMQEVLKSTVRQFDRMREAKEELIKEAQALNLPKLELIANEFVTEEAFQSYLEMIEHLRESLSHVAKDLRKLNFKQFPKGTRKDLKFITRFYLVLEKLRFITTWFEDIASYTTVVGGIGYETGVITSQSEIEKDVVLKVEDIFKNYHTGGGTIYALRGVSFEIKKGEFVGVIGPSGSGKTTLLNIMAGLDNPDRGAVYVDGMNLQSLNDKQLTSLRRDKMGFIFQFYNLIPMLTNKENVAYPAEVGGNTKDLSNRVSNKLKSVQLEQFERQYPNKLSGGQMQRVTIARSLINTPSILFADEPTGDLDSVTGEEIMNLLSSFNKEHETTVIMVTHDRSLLKYCNRIIDMKDGRLIEELP
>gnl|TC-DB|P37908|9.A.40.2.4 UPF0053 inner membrane protein YfjD OS=Escherichia coli (strain K12) GN=yfjD PE=1 SV=5
MEHISTTTLIIILIIMVVISAYFSGSETGMMTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYGDAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQILMMPLVWLLNAITRMLMRMMGIKTDIVVSGSLSKEELRTIVHESRSQISRRNQDMLLSVLDLEKMTVDDIMVPRSEIIGIDINDDWKSILRQLSHSPHGRIVLYRDSLDDAISMLRVREAWRLMSEKKEFTKETMLRAADEIYFVPEGTPLSTQLVKFQRNKKKVGLVVNEYGDIQGLVTVEDILEEIVGDFTTSMSPTLAEEVTPQNDGSVIIDGTANVREINKAFNWHLPEDDARTVNGVILEALEEIPVAGTRVRIGEYDIDILDVQDNMIKQVKVFPVKPLRESVAE
>gnl|TC-DB|A8WGR6|1.H.1.1.17 Claudin OS=Danio rerio GN=cldn10b PE=2 SV=1
......@@ -15730,6 +15780,8 @@ MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESIL
MRQTITRCRNRLTFGLWLTILGGGHWVESSACAQEPTPKAAVSPSPAVEERLRRLEEVNARLLERLDRDRDESAQRYRVLEERYRELQRRLGEPPATPALKADVPPETGEATARRSHLGRPGELGKALSVRELPLKARFADGFQLASEDEEFDLRFHVLNQTDAEVFAPNNRTFGKSGLYIPRVRLYLEGRLTKLWDYEVSLQRSLEGSWDLLDGNVNFHPSDAFQVKFGRQLVPYSYDWFDHLEQYFIAPERALFPLNFGLSRQAGLMGWGHAREGKLDWALGVFNGHLTGLADNNPNLEGVGYLNFRPFLGSEQFPALHHLNVGASGSIGEITRNDTPLPMRTSVQSSDNDEAAEDASAVFLAFNKGTVYQGARRFAAVHLAYYYHGLSFESEWNIGRFQMTRPGLGNKPEIPVGGFHTTLSYFLTGEQIERRTVVQPLRPFQPFHGEWGLGAFEPFIRYSQLNLGENLFTEGLAEGRLWSNDAGMIDLGMNWYPNRWVKFYLTWQHAMFGSPVLVNEAKNTFSRDMNLFWVRGQVYF
>gnl|TC-DB|D6TJQ1|3.A.1.26.1